PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02298.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARF
Protein Properties Length: 1274aa    MW: 143320 Da    PI: 7.3289
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02298.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B366.44.1e-21131231198
                              EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                              f+kvlt sd++++g +++ +k+a+e+     ++++  +++l+ +d++  +W +k+i+r++++r++lt+GW+ Fv++++L ++D++v
  Sme2.5_02298.1_g00001.1 131 FCKVLTASDTSTHGGFSVLRKHANEClppldMSQPIPTQELIAKDLHDVEWHFKHIFRGQPRRHLLTTGWSTFVSSKKLVARDSFV 216
                              99****************************9555555669********************************************** PP

                              EEE-SSSEE..EEEEE- CS
                       B3  82 Fkldgrsefelvvkvfr 98 
                              F   + ++++l+v+v r
  Sme2.5_02298.1_g00001.1 217 FL--RGEDGQLRVGVKR 231
                              **..4489999999865 PP

2Auxin_resp90.33.4e-30257336183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              ++ha++t+++F v Y+Pr+  s+F+v ++k+++a+++ +svGmRf+m+fe+e+ + rr++Gt+vgv dl++ +W+nS W sLk
  Sme2.5_02298.1_g00001.1 257 VSHAVTTQTMFVVNYKPRT--SQFIVGLNKYLEAVSHGYSVGMRFQMQFEGEENPDRRYMGTIVGVDDLSS-QWKNSAWWSLK 336
                              679***************6..9**********************************************777.*******9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.49E-36122260IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.1E-37124246IPR015300DNA-binding pseudobarrel domain
CDDcd100175.05E-18129231No hitNo description
PROSITE profilePS5086310.348131233IPR003340B3 DNA binding domain
PfamPF023623.1E-19131231IPR003340B3 DNA binding domain
SMARTSM010192.7E-18131233IPR003340B3 DNA binding domain
PfamPF065075.5E-28257336IPR010525Auxin response factor
PfamPF023093.0E-13561658IPR033389AUX/IAA domain
SuperFamilySSF542772.35E-11568649No hitNo description
PROSITE profilePS5174522.936573667IPR000270PB1 domain
PfamPF035528.7E-49717911IPR005150Cellulose synthase
SuperFamilySSF534481.13E-10786910IPR029044Nucleotide-diphospho-sugar transferases
PfamPF035524.9E-469291200IPR005150Cellulose synthase
SuperFamilySSF534481.13E-109601093IPR029044Nucleotide-diphospho-sugar transferases
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0030244Biological Processcellulose biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0016760Molecular Functioncellulose synthase (UDP-forming) activity
Sequence ? help Back to Top
Protein Sequence    Length: 1274 aa     Download sequence    Send to blast
MANCNSNGCY QSQQKNNFSA QVRGKDHLYR ELWKLCAGPL VDVPKNGERV YYFPQGHMEQ  60
LEASINQEMN ERVPTFNLEP KILCSVIHID HLAEQDSDEV YARVILMPDG AKPAVPDPSP  120
PEPARPKGHS FCKVLTASDT STHGGFSVLR KHANECLPPL DMSQPIPTQE LIAKDLHDVE  180
WHFKHIFRGQ PRRHLLTTGW STFVSSKKLV ARDSFVFLRG EDGQLRVGVK RLGHQQSSMP  240
SSVISSQSMH LGVLATVSHA VTTQTMFVVN YKPRTSQFIV GLNKYLEAVS HGYSVGMRFQ  300
MQFEGEENPD RRYMGTIVGV DDLSSQWKNS AWWSLKVRWD EPALFPRPDR VSPWEIEPYM  360
SSITKVPGHP TAGKNKRKRT NNETKISGSN ENSQQQDPAS STALAVWSPS LDVPQFNASG  420
TNNSTHRTLT SHAEGGWLLP HLNTSGMLVD EKEDSKSASA WSGLTFVLTP QFAQGTNQPI  480
VSHADERKCD TITTCRLFGI NLKSSSMNTT EALLPPQSTD ISCVSAEREP PNTVPAGDSD  540
QKSDLSLDFI DQMLGHLQLP QKEVQSKQSC STRTRTKVQM QGVAVGRAVD LTALKGYDEL  600
TKELEEMFEI QGELHSRNKW EIVFTDDEGD TMLMGDYPWQ DFCNVVRRIF ICSTQDMKKL  660
TLSRADKRLL TTIISHSIIH SNNTTSSKTE TAAAAKTETA AAAMNSGGLH SVEVNRLQLM  720
YESMKIRIEK VIERGKVDED YINNEEELQA FTKFWTNGFT RNNHPSIIQV LLESGKDKDI  780
TSHGMPNLIY LSREKNKSCP HHFKAGALNA LLRVSGIMTN APIILTLDCD MYSNDPSTPH  840
RALCYFLDQT LSPNLAYVQF PQKFHGLNEA DIYASEIKGL FITNPIGMDG LCGPNYVGTG  900
CFFRRRAFFG SPSSFEQPEI PELFPDHVVN RPIKAQEILR RAHYVASCNY ESESDWGSKM  960
GFKYGSLVED YYTGYRLQCE GWKSVFCNPK RPAFLGDVPI SLCDVISQQK RWCVGLLEVG  1020
FSKYSPLTFG VKSMGFVMAH CYTHYAFWPI WSIPLTIYAF IPQLTLLNGV AIFPKVSDPW  1080
FFLYVFMFLG AYGQDCLVFI SYQGTFRRWW SDQRIWMIRG LTCCLFGTIE YLTKRLGIST  1140
QGFNITSKVV DNDQGKRYHQ GIFEFGVVSP MFMTLATTSI INLVAFLKSL AQIFNGEHPM  1200
FVTLATTSII NVVALLKSLA QILKGDQNLD ELFIQMFIAG FVVINCLPIY EAMVLRSDKG  1260
RMPTRVTIFS TFLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1512636117357Auxin response factor 1
4ldw_A1e-1512636117357Auxin response factor 1
4ldw_B1e-1512636117357Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343828.10.0PREDICTED: auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLM1AWK90.0M1AWK9_SOLTU; Auxin response factor
STRINGPGSC0003DMT4000319650.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9