PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02290.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 867aa    MW: 97026.5 Da    PI: 7.871
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02290.1_g00006.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA48.61.1e-15741135
                     GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                             C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Sme2.5_02290.1_g00006.1  7 CYHCGVTSTPLWRNGPPEKPILCNACGSRWRTKGT 41
                             ****************66666***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.4E-10153IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.76E-11445No hitNo description
CDDcd002021.77E-16655No hitNo description
PfamPF003201.7E-13741IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.0E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF139191.9E-8285364IPR028020ASX homology domain
SuperFamilySSF1035113.27E-10742815IPR023329Chlorophyll a/b binding protein domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 867 aa     Download sequence    Send to blast
MGKEGPCYHC GVTSTPLWRN GPPEKPILCN ACGSRWRTKG TLANYTPLHA RAEPCDFEEH  60
RVSRLKNMSM KNKEAKVLKR KKNHDNAEVG TTPDYYLGFR KGLDEDTSNR SSSGSAVSNS  120
ESCAQFGSAE ASDLTGPAQS NIWDTTVPSR KRTCFNRPKP SSVEKLRKDL YTILHEQQSS  180
YLSASSEEEL LFESDKPMVS VEIGHGSVLI RHPSSIGREE ESEASSLSVE NKHRSVSDTY  240
SRLTTPPVNV NKGVNSPNVS TERTKKPTGL ALGQDQIRRN KDHLEKLQIL GHHNSPLRYI  300
DLKDVLNYDE FTSHFSSDEQ QQLLKYLPSV DSFAPPDSLR SVFESSQFEE NLFSFQKLLA  360
EGVFDNSLPG VKLEDCRTLK RFILCYLMKS KWVQQYNLLK DTICKNSSSS EVAGDPNVVG  420
TCHSANVKKP QEGQHPKCSG AKTAMKSPKR VVMKSIYEQK ELIDNDGSCF SPRSSFALPS  480
ENSSLVQDSF RSANENSHQD LLLDVPSNSY CPQAELLLPT SSFTTQASTS SSSMYPPHLG  540
WKWHGVRGCL TSIIMINDSS RRDLLLNSQK NFCCSILAGI EPLLSRLCYR KLWGSWNRRA  600
LILSFSSTMS ISLFSSPPPH FPSLSPPKPH LTHKPFLPLP FKKPHLPFLI SRKSIDDASS  660
SSSTAAVTIE QEKDVKDEGS NGVPLNSNGA SLAVAAGALA TETEEVRKFK DARWVAGTWD  720
LKQFEKDGKV HWDSVIDAEV RRRKWLEDNP ESSSNEEPVL FDTAIIPWWA WMKRFHLPEA  780
ERLNGRAAMI GFFMAYFVDS LTGVGLVDQM GNFFCKTLLF VAVAGVLLIR KNEDLETLKK  840
LLEETTFYDK QWQASWKDET SGNSKDS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755201e-164HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
GenBankHG9754471e-164HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015085711.10.0PREDICTED: GATA transcription factor 26-like isoform X1
SwissprotQ8W4H11e-140GAT26_ARATH; GATA transcription factor 26
TrEMBLM1BTZ40.0M1BTZ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000528000.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20892462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-131GATA transcription factor 26