PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02281.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 332aa    MW: 35907.9 Da    PI: 6.8046
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02281.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.76.3e-3446100155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              k+rlrWt++LHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Sme2.5_02281.1_g00001.1  46 KQRLRWTNDLHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 100
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.74643103IPR017930Myb domain
SuperFamilySSF466891.25E-1745100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-3245101IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-2646101IPR006447Myb domain, plants
PfamPF002494.8E-94899IPR001005SANT/Myb domain
PfamPF143793.0E-22132178IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MYQPKGVPGS SLAHNNAAVN SQSLDSGGSS MDPTSGGNNN ASLASKQRLR WTNDLHERFV  60
DAVAQLGGPD RATPKGVLRV MGVQGLTIYH VKSHLQKYRL AKYLPDSSSD GKASDKKEPR  120
DMLSSLDGSS GVEITTALKL QMEVQKRLHE QLEVQKQLQL RIEAQGKYLK KIIEEQQRLS  180
GVLSEVPGSG VTAPPTGDNG PESDNRTDPG TPPPSSESPH VDKPVKAHAP TTNLSMDESF  240
SSHHEPLSPD SDCQETSLME SPNGERSSKK QRVGTSAAFT KDNVALPHQI LESSLSPPYQ  300
QPHSVFMMRD QFNHTSGLSL GIEDQKVSGS NI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-2346103158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-2346103158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-2346103158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-2346103158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016556346.10.0PREDICTED: protein PHR1-LIKE 1
SwissprotQ9SJW01e-118PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A1U8FCD00.0A0A1U8FCD0_CAPAN; protein PHR1-LIKE 1
TrEMBLA0A2G2ZAZ50.0A0A2G2ZAZ5_CAPAN; Protein PHR1-LIKE 1
STRINGPGSC0003DMT4000190990.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27962451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-112G2-like family protein