PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02078.1_g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family FAR1
Protein Properties Length: 737aa    MW: 83806.9 Da    PI: 7.0519
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02078.1_g00011.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR196.43.2e-3052141291
                     FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnH 87 
                              fYn+YA++vGF +r+s+ ++s+r++ i +r++vCskeg++ + +++++k +r+r ++r+gCka+++vkk++ gkw +tk+ ++HnH
  Sme2.5_02078.1_g00011.1  52 FYNSYARRVGFGTRVSAYRRSRRDNAISTRQLVCSKEGFNPRPDNAQRKPKRQRIVSRVGCKAHMTVKKQTFGKWAITKFIKDHNH 137
                              9*********************************************99************************************** PP

                     FAR1  88 elap 91 
                              el+p
  Sme2.5_02078.1_g00011.1 138 ELVP 141
                              **86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.3E-2752141IPR004330FAR1 DNA binding domain
PfamPF105511.3E-27236326IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 737 aa     Download sequence    Send to blast
MEPEPFNLED DAMEFDRKED GQSASGLDLG QQSDLEPYEG MEFESEQAAR IFYNSYARRV  60
GFGTRVSAYR RSRRDNAIST RQLVCSKEGF NPRPDNAQRK PKRQRIVSRV GCKAHMTVKK  120
QTFGKWAITK FIKDHNHELV PPDQIHLIRS HRHVSGPARS LIDTLQAAGL GATGVMSVLI  180
KQRTLGTGAQ YIFDYLKQKQ AEDPDFFYAI QGGSSGNIFW ADSTSRMNYS YFGDTVIFDT  240
TYRTHRYRVP FAPFIGVNHH CQPVLFGCAL LLNESESSFI WLFQNWLAAM SGRHPVSITS  300
DHDRIIRSAI VDVFPGTRHR FCKSNIFREA QERLSQSLQS FPTFEAEFQK CVNLTETIEE  360
FELCWGSLLG RYNLIDDEWL QSIYDARQHW VPVYLRDAFF GETSIAKTSD STNSFFDGYI  420
DASTNIHILM SQYEKAIASR HEKEVKADYD TINIVPILKT PSPMEKQAAN IYTREIFLMF  480
QQELIETLAY PATVINDTGH ILAVFRVKNV LRLLSHYVLK RWTRKAKSEV VLDEDKLGLP  540
SSHNDSYTDR FEKLSLEATK YVKEGVDSEN VYLVAMDALC EASKKVAAAI RGTSALPPSL  600
DMNKGMELTL NGNQADCDDS SLRGTFVCVH PTLPRPHLWD FTGSNRIARQ EMEATKNGDK  660
SASAMEAFEK LEKVGEGTYG KSQDEKIQEL TIAVVNATEI CKAYRAKLLS ILREMEEQKL  720
RISLKEGLSC KSFRLYG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199104KPKRQR
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015073245.10.0protein FAR1-RELATED SEQUENCE 5-like
SwissprotQ9SZL80.0FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A3Q7GBB00.0A0A3Q7GBB0_SOLLC; Uncharacterized protein
STRINGXP_009798613.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.10.0FAR1-related sequence 5
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]