PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02055.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 253aa    MW: 28132.5 Da    PI: 7.5036
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02055.1_g00009.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.77.5e-19177211135
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                              Cs+Cg+ kTplWR gp g+ktLCnaCG+++++ +l
  Sme2.5_02055.1_g00009.1 177 CSHCGVQKTPLWRTGPLGEKTLCNACGVRFKSGRL 211
                              *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.8E-701250IPR016679Transcription factor, GATA, plant
SMARTSM004013.4E-15171221IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.308174207IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.1E-15175209IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.71E-14176234No hitNo description
CDDcd002024.30E-16176226No hitNo description
PfamPF003201.5E-16177211IPR000679Zinc finger, GATA-type
PROSITE patternPS003440177202IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MDYSGDDLFV NDLLDLSNGF PEDEGDENKP SPPQNKEDDK EKFPHIPPSV KQDFGTELSL  60
PGADLDNLEW LSHFVDDSFS EYSLTYSAGN LPEKSLKIHP NGQIPVRENS CFTGPFRAER  120
QKSSTRLWPP PVSFSSSSST TATNIRSQLS ESVENQPPAR KPKKKMEKRV GIGAKQCSHC  180
GVQKTPLWRT GPLGEKTLCN ACGVRFKSGR LLPEYRPASS PTFSTGLHSN SHRKVLEMRQ  240
KKETEPGLPV QGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006347003.11e-133PREDICTED: GATA transcription factor 5-like
TrEMBLM1AVJ61e-133M1AVJ6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000313561e-133(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11542481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.18e-54GATA transcription factor 7