PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01757.1_g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 217aa    MW: 23864.5 Da    PI: 6.3649
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01757.1_g00011.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.21e-2492143153
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 
                              k +++WtpeLH++Fv+ave+L G +kA+P++ilelm+ +gLt+++++SHLQ++
  Sme2.5_01757.1_g00011.1  92 KVKVDWTPELHKKFVKAVEKL-GVDKAVPSRILELMDTPGLTRHNIASHLQRF 143
                              5689*****************.*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.39289148IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-2390143IPR009057Homeodomain-like
SuperFamilySSF466899.86E-1690144IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-2292143IPR006447Myb domain, plants
PfamPF002493.0E-895142IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MLGVSPPLSY TNENENYDLF QDFPDGNLIG TVNFDDLFEG INGGDLLPDL EIFAEFSVSN  60
CNESANNVNM KSKSKEAKKS SGQIKNPQGK RKVKVDWTPE LHKKFVKAVE KLGVDKAVPS  120
RILELMDTPG LTRHNIASHL QRFAAPLMVP GIPLPPAIIK VDKISSDLHP SKESIDAAIE  180
DVLAKPQMPL PIGLKPPSID SVLKELQRHE ITKIPPT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-1589147260ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that functions with GLK1 to promote chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. Acts in a cell-autonomous manner to coordinate and maintain the photosynthetic apparatus within individual cells. May function in photosynthetic capacity optimization by integrating responses to variable environmental and endogenous cues (PubMed:11828027, PubMed:12220263, PubMed:18643989, PubMed:19376934, PubMed:19383092, PubMed:19726569). Prevents premature senescence (PubMed:23459204). {ECO:0000269|PubMed:11828027, ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:18643989, ECO:0000269|PubMed:19376934, ECO:0000269|PubMed:19383092, ECO:0000269|PubMed:19726569, ECO:0000269|PubMed:23459204}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. Repressed by BZR2. {ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:21214652}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF8079481e-126JF807948.1 Solanum phureja golden 2-like 2 transcription factor (GLK2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018623137.13e-70PREDICTED: transcription activator GLK1-like isoform X3
SwissprotQ9FFH08e-28GLK2_ARATH; Transcription activator GLK2
TrEMBLM1BZ726e-68M1BZ72_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000562552e-68(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.14e-28GOLDEN2-like 2
Publications ? help Back to Top
  1. Leister D,Kleine T
    Definition of a core module for the nuclear retrograde response to altered organellar gene expression identifies GLK overexpressors as gun mutants.
    Physiol Plant, 2016. 157(3): p. 297-309
    [PMID:26876646]
  2. Nagatoshi Y, et al.
    GOLDEN 2-LIKE transcription factors for chloroplast development affect ozone tolerance through the regulation of stomatal movement.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(15): p. 4218-23
    [PMID:27035938]
  3. Han XY, et al.
    GOLDEN2-LIKE transcription factors coordinate the tolerance to Cucumber mosaic virus in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2016. 477(4): p. 626-632
    [PMID:27346129]
  4. Ni F, et al.
    Turnip Yellow Mosaic Virus P69 Interacts with and Suppresses GLK Transcription Factors to Cause Pale-Green Symptoms in Arabidopsis.
    Mol Plant, 2017. 10(5): p. 764-766
    [PMID:27964999]
  5. Bastakis E,Hedtke B,Klermund C,Grimm B,Schwechheimer C
    LLM-Domain B-GATA Transcription Factors Play Multifaceted Roles in Controlling Greening in Arabidopsis.
    Plant Cell, 2018. 30(3): p. 582-599
    [PMID:29453227]
  6. Zubo YO, et al.
    Coordination of Chloroplast Development through the Action of the GNC and GLK Transcription Factor Families.
    Plant Physiol., 2018. 178(1): p. 130-147
    [PMID:30002259]