PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01694.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family SBP
Protein Properties Length: 557aa    MW: 60839.1 Da    PI: 8.5435
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01694.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.14.7e-42169244277
                              -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                      SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                              Cqv+gC +dl+++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+ 
  Sme2.5_01694.1_g00002.1 169 CQVQGCGKDLTSCKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLGEFDDGKRSCRKRLAGHNERRRKPP 244
                              **************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-33163230IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.718166243IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-39167247IPR004333Transcription factor, SBP-box
PfamPF031102.6E-31169242IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MESWSYFSAG KGFVTEESVS VNNGMGRVKN GVMGWELKTQ SSYGMCLSQE GSESQGFHEL  60
GSPNLMRKPI FCDQMRDGFT SNKHGGAASI FGSFSGEDKS SSKLSSSVVD SVSRDSSLID  120
LKLGRFPDHH VDGTIFKSPK SLSSSTSAES IVPAKRLRAG SVNSHKPFCQ VQGCGKDLTS  180
CKDYHKRHKV CEVHSKTAKV IVNGIEQRFC QQCSRFHLLG EFDDGKRSCR KRLAGHNERR  240
RKPPHTVHLI AHEGAEICLM IEGLDPISIL QNKVLTGTRF RGTSFVTSSF ACQDILGNRF  300
LHQPKYEMND WYKNVKVEDG VDYSPQLAMP FTNGQLQPKS HFTSYHAKKG CHTLHDGLSA  360
VTSSRINEST NSSLHDMRGS DFVSPSVFHT TSTGSEILHA LDTSSTIQGL SGISNSNNAL  420
SLLSSQSQGS SNHSTVFSTS RPLIPPSNNY NVTQASKNVL GLGPLVSAGR MSNTFNSSGV  480
NSAEDGLDQI LFPSNTCGIN RIIQGSDLVN PKNQLSCEDG PTIDLLQLSS QLQRVEHQRF  540
SMQVKQDSNA FPGLRIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-291682421084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754420.0HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001334260.10.0squamosa promoter-binding-like protein
TrEMBLA0A3Q7FQM40.0A0A3Q7FQM4_SOLLC; Uncharacterized protein
STRINGPGSC0003DMT4000630460.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-45SBP family protein