PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01620.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 358aa    MW: 40167.3 Da    PI: 8.0178
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01620.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.91.9e-32230285156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+peLH+rFv+a++qLGG+++AtPk+i+++m+v+gLt+++vkSHLQkYRl+
  Sme2.5_01620.1_g00005.1 230 KQRRCWSPELHRRFVDALHQLGGAQVATPKQIRDIMQVDGLTNDEVKSHLQKYRLH 285
                              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.047227287IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-30227288IPR009057Homeodomain-like
SuperFamilySSF466891.79E-17228288IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-26230285IPR006447Myb domain, plants
PfamPF002491.5E-7232283IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGLNSKEMNI DLNFVYVPKL ISDVLTEVSA MDDFSKKLTK LNQFVVALEE ELSKIEAFQR  60
ELPNCMILLK DAIERLKVEG LQYKEKNKRP LMEEFIPLKK GNSDESGRVK RSDDLNDKKN  120
WMSSAQLWST PVQYENSDLE KQGHFTNLKH SGVEGKLKSE RGAFLPFQGQ GLKEGKNGLA  180
VKDLSLSMAV TMGEGEKGQK PIDVSVKRDK GPSNPNGCSV FSQDKSQQRK QRRCWSPELH  240
RRFVDALHQL GGAQVATPKQ IRDIMQVDGL TNDEVKSHLQ KYRLHVRRVP VSGCSWSNMD  300
EIGESSKENG TQSGSPEGPL HFTGSGSAKG VSNNEEEDNK SESYNWNGHH PKSIEAHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A9e-14230283154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-14230283154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-14230283154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-14230283154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-112HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006338223.10.0PREDICTED: uncharacterized protein LOC102591830
TrEMBLM1AMN50.0M1AMN5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000260960.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA84972229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.15e-51G2-like family protein