PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01521.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ZF-HD
Protein Properties Length: 292aa    MW: 32334.1 Da    PI: 8.6193
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01521.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.92.1e-3268122257
              ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                              +++rY+eClkNhAa++Gg+++DGCgEfmps geegt +alkCaAC+CHRnFHR+e 
  Sme2.5_01521.1_g00001.1  68 SRARYRECLKNHAANIGGNVTDGCGEFMPS-GEEGTLEALKCAACNCHRNFHRKEL 122
                              5789*************************9.999********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047707.5E-3070121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.5E-3171121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2271122IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.71572121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.24E-16217279IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28220282IPR009057Homeodomain-like
TIGRFAMsTIGR015652.4E-28221278IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MALTGEEKEM RMSGSLGYHS LDQNIDHTVP PNIQDQSTGG GSGAAPVAGV APHNSSAGSN  60
KFNKVTSSRA RYRECLKNHA ANIGGNVTDG CGEFMPSGEE GTLEALKCAA CNCHRNFHRK  120
ELPNNGDNNN NNPGIMVVHP LQLPQPLPTP IPSMNHHHHH HHQHRGRSIW TTMPPQPVKM  180
AFGASGGSGA TDSSSEELNF NTYHHQQATS VPPQQPFLLA KKRFRTKFSQ EQKEKMLEFA  240
EKLGWRIPRE DDTEVQSFCS QVGVKRQVFK VWMHNNKNPS AKKNINQEDQ QP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-242222781874ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Binds DNA at 5'-ATTA-3' consensus promoter regions. Regulates floral architecture and leaf development. Regulators in the abscisic acid (ABA) signal pathway that confers sensitivity to ABA in an ARF2-dependent manner. {ECO:0000269|PubMed:16428600, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21779177}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by abscisic acid (ABA) and ARF2. {ECO:0000269|PubMed:21779177}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754431e-123HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016568547.11e-145PREDICTED: zinc-finger homeodomain protein 6
SwissprotQ9FRL51e-58ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLA0A1U8GB321e-144A0A1U8GB32_CAPAN; zinc-finger homeodomain protein 6
TrEMBLA0A2G2V5W81e-144A0A2G2V5W8_CAPBA; Zinc-finger homeodomain protein 6
TrEMBLA0A2G3AX591e-144A0A2G3AX59_CAPCH; Zinc-finger homeodomain protein 6
STRINGPGSC0003DMT4000095811e-139(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.19e-51homeobox protein 24