PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01509.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 619aa    MW: 67945.4 Da    PI: 4.9144
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01509.1_g00006.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.43.2e-33246300155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              k+r+rWtpeLHe+Fveav++LGGsekAtPk +l+lmkv+ Lt++hvkSHLQkYR+
  Sme2.5_01509.1_g00006.1 246 KQRMRWTPELHEAFVEAVNKLGGSEKATPKGVLKLMKVETLTIYHVKSHLQKYRT 300
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.98243303IPR017930Myb domain
SuperFamilySSF466895.02E-18244300IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-31244302IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-25246300IPR006447Myb domain, plants
PfamPF002493.9E-10248299IPR001005SANT/Myb domain
PfamPF143795.3E-8331352IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PfamPF143799.6E-10508533IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    Send to blast
MEARPALSVQ RTGAHQLSNF GASGAHSSLP VLQTSLEEKY PKLPGPVLSS FPSNDGAVSH  60
LFSSSSGFST NLHFSSVPAH EEHLAPATSI SQPTTNEASI PLANSGVLQC AASSQYADVN  120
SEPWFTELLP DYLDYPINTP VQNSQLDCRN TGECHIPPED LSKQSDWPEW ADLVMNDDDA  180
LTSNWNEVNF DTSIADAEPK MQYQEQNQPS NFPVHQVQSL QQIPTASVET SAVVPASSSA  240
SGSSSKQRMR WTPELHEAFV EAVNKLGGSE KATPKGVLKL MKVETLTIYH VKSHLQKYRT  300
ARYKPEASEG SSEKKESSIG NLSALDLKTG IEITEALRLQ MEVQKQLHEQ LEEDSLSCII  360
LLEIDSGCCL FGIKWLLGMA SSLLPFVFFP LYLHKVGHRI IVVFLSIKDM LTTICKLEYS  420
PPLLLAFASS SPDPATQQYL PSQTSPLDYQ PYKTFDHGWC LACPDMSPPS QSEALPSSQF  480
LPIELVNCEP SIPKSVPMRL YGLSTRPIQR NLQLRIEEQG RCLQMMFEKQ CKSMPGIDLA  540
KGSSSMAEDA SAQLTDAVQS SSNKNDPGVS LVDHQEAGSY TTQKVGEKQK EQERDLGNPE  600
TNITSSSNSP PLKRAKVNE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-31246304260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-31246304260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-31246304260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-31246304260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-31246304260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-31246304260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-31246304260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-31246304260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0176930.0AB017693.1 Nicotiana tabacum WERBP-1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006364564.10.0PREDICTED: protein PHR1-LIKE 1
TrEMBLA0A0V0IJ680.0A0A0V0IJ68_SOLCH; Uncharacterized protein
STRINGSolyc06g008200.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-52phosphate starvation response 1