PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01409.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 447aa    MW: 50275.1 Da    PI: 6.9464
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01409.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS273.56.8e-84764434374
                     GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalkl....f 84 
                              lLl  Ae +++++l +a++lL+   + + ++g+p++R++ yf+e L++r+ + ++++  +  ++ + +++n +e l+  ++     
  Sme2.5_01409.1_g00005.1  76 LLLVSAETLANRQLDCARKLLNLFINFSLSAGNPVRRVVYYFAESLRKRIDK-GTGIPTITaNMDAVNPNNLEELLMDPRTdvieT 160
                              78889**********************************************9.555554443666666677777777777777789 PP

                     GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfA 169
                               ++ P+ k++++t  qaI++++++ +r+H iD++i+ G QW  L+qaL    e pp  l+iT+vg     s ++++e+g+rL++fA
  Sme2.5_01409.1_g00005.1 161 EQMLPFRKVTQFTGIQAIVDSIKSFKRIHLIDLGIKSGSQWTILMQALVGNGECPPeLLKITAVGT----SLTRMQEIGKRLTSFA 242
                              9************************************************8876666599*******....9*************** PP

                     GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                              ++lg+pf+f++ v+++l +++ + ++ + gE++aV +  +l +ll+ + +l+s    +++++ksl P v+vv+e ea++n++ F +
  Sme2.5_01409.1_g00005.1 243 DTLGIPFSFKT-VVSDLRNIRKDFFESRVGEVVAVYSDSRLWTLLAWPNHLQS----LIQVIKSLHPCVMVVTEIEANTNTPIFID 323
                              ***********.7999*****************************77766666....***************************** PP

                     GRAS 256 rflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                              rf eal yysa+fdsle+ ++ ++++r +   ++lg+ i+nv++ eg+e ++rhe+l++Wr+ ++ +G ++ +ls++   qakll 
  Sme2.5_01409.1_g00005.1 324 RFNEALFYYSAIFDSLETCIGWNHQHREVAQGVYLGKVIENVITSEGEEMVHRHEKLGSWRALFKGFGIEETELSHSSLYQAKLLA 409
                              ************************************************************************************** PP

                     GRAS 342 rkvksdgy.rveeesgslvlgWkdrpLvsvSaWr 374
                              ++   +g+ ++e + +sl++ Wk+ p+ s+SaW+
  Sme2.5_01409.1_g00005.1 410 EESTCHGFcSLEMDGKSLIIKWKGTPIKSLSAWK 443
                              ****999637889999999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.82347422IPR005202Transcription factor GRAS
PfamPF035142.4E-8176443IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MYKSKGKVND MNLDIPSHIS GCSPVLSTTT IMRIAKEQLQ LYTSQNHDSS SIILSPLIAD  60
FGLSPQVKEE VELALLLLVS AETLANRQLD CARKLLNLFI NFSLSAGNPV RRVVYYFAES  120
LRKRIDKGTG IPTITANMDA VNPNNLEELL MDPRTDVIET EQMLPFRKVT QFTGIQAIVD  180
SIKSFKRIHL IDLGIKSGSQ WTILMQALVG NGECPPELLK ITAVGTSLTR MQEIGKRLTS  240
FADTLGIPFS FKTVVSDLRN IRKDFFESRV GEVVAVYSDS RLWTLLAWPN HLQSLIQVIK  300
SLHPCVMVVT EIEANTNTPI FIDRFNEALF YYSAIFDSLE TCIGWNHQHR EVAQGVYLGK  360
VIENVITSEG EEMVHRHEKL GSWRALFKGF GIEETELSHS SLYQAKLLAE ESTCHGFCSL  420
EMDGKSLIIK WKGTPIKSLS AWKFYHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-4110644336375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389080.0AC238908.8 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-126f9 map 1, complete sequence.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006358212.10.0PREDICTED: DELLA protein RGL2-like
TrEMBLK4AWA30.0K4AWA3_SOLLC; Uncharacterized protein
STRINGSolyc01g059960.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.18e-61RGA-like 2