PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01402.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRF
Protein Properties Length: 457aa    MW: 49909.4 Da    PI: 6.8955
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01402.1_g00013.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.27e-24127170245
                      WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                               epgrC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e 
  Sme2.5_01402.1_g00013.1 127 LEPGRCKRTDGKKWRCSRDVAPQQKYCERHMHRGRPRSRKHVEV 170
                              69***************************************985 PP

2QLQ49.61.2e-1766100236
                      QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                              +FT+aQ+ +L++Q+++yKy+++   vPp+Ll+ i+
  Sme2.5_01402.1_g00013.1  66 PFTWAQWKELERQAMIYKYMVSAISVPPDLLLSIC 100
                              8*******************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-865101IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.5E-1266100IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.27366101IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.005126170IPR014977WRC domain
PfamPF088791.8E-19128169IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MMGHHQDPHC SSSDGGANEM PCSSDEASLL FPAPPATGSA AVVRTLQPFD ISTDSQGGMA  60
TALGHPFTWA QWKELERQAM IYKYMVSAIS VPPDLLLSIC TNSSGASHAT SATGSVQGQR  120
YTNIRDLEPG RCKRTDGKKW RCSRDVAPQQ KYCERHMHRG RPRSRKHVEV SSGSDNKKTR  180
IHHAPLESTP MVVPIPTPAG QINSPSTKQP LRSTFQQIQD PLNSGWMTKG ELVAKANSGQ  240
QWQHFMNSTA GYSADGSVHS DFQHCYREEA LNLLASRNLE RTEDVSVNKH NGEFNFMINP  300
ELVKDASRDL INAWSDDNVY NNSNNENMEA SLWPSLGNIL PSSLTLSIAR AAGDVLDEDM  360
GLDSKFLNAN QHKFWGNSFP FASGGPLAEA LHPSSSINLR YTSNGESISP AATTVSSPSG  420
VLQKTSFSHS DSSVCNSPVL AAPTNVTHES VQFQWLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755151e-111HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006347500.10.0PREDICTED: growth-regulating factor 3
RefseqXP_006347501.10.0PREDICTED: growth-regulating factor 3
TrEMBLA0A1U8G6F00.0A0A1U8G6F0_CAPAN; growth-regulating factor 8-like isoform X2
TrEMBLA0A2G3A0350.0A0A2G3A035_CAPAN; Growth-regulating factor 5
TrEMBLA0A2G3CXR00.0A0A2G3CXR0_CAPCH; Growth-regulating factor 7
STRINGPGSC0003DMT4000083520.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.13e-34growth-regulating factor 7