PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01395.1_g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ZF-HD
Protein Properties Length: 203aa    MW: 23073.5 Da    PI: 8.8769
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01395.1_g00011.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer62.49.1e-20963358
              ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                              v+Y eC++N A++  gha+DGC Ef+p  g+  t +al CaA  CHR+FH+r ++
  Sme2.5_01395.1_g00011.1  9 VVKYCECRHNYAVRSMGHALDGCSEFCPI-GTPDTLKALICAAFHCHRSFHKRVEV 63
                             589*************************9.66679*****************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-10366IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.7E-181062IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.7E-161160IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152318.5261261IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.1E-9138194IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MASNNNRLVV KYCECRHNYA VRSMGHALDG CSEFCPIGTP DTLKALICAA FHCHRSFHKR  60
VEVELENGVE ISHPIDATPL VTLDIPPLQY LVKPRAQVVE PLLQNNNNSD NSEKETKEDV  120
LQVAELELKD RGSSSSSVKM KLSPDQKKKV LAFTQDIMGW KWSKNNEQVI PFCAEVGITP  180
RFLKNWINNN RRRIGPLKKN TKY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015054791.11e-75zinc-finger homeodomain protein 4-like
TrEMBLA0A3Q7EQA52e-69A0A3Q7EQA5_SOLLC; Uncharacterized protein
STRINGSolyc01g103830.1.19e-76(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA108891118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.24e-25homeobox protein 31