PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01247.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Dof
Protein Properties Length: 371aa    MW: 41024.8 Da    PI: 7.7778
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01247.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.4e-3998158262
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk++s
  Sme2.5_01247.1_g00005.1  98 PDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGSGRRKNKSVS 158
                              7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3295155IPR003851Zinc finger, Dof-type
PfamPF027013.4E-32100156IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.593102156IPR003851Zinc finger, Dof-type
PROSITE patternPS013610104140IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MSEVRDPGIK LFGKTILLRV DDLRSSSINT TSHDDKIISE GELTQSNKNR DDFTNSTVDH  60
ELVEPEILSG ISDDTKIKDV DKDPSENSGT EEKVVKKPDK ILPCPRCNSM ETKFCYYNNY  120
NVNQPRHFCK KCQRYWTAGG TMRNVPVGSG RRKNKSVSNS SYRHIMVSDV LQGASGSVLA  180
FGADKPLCDS MASRLDLAEN SIQNGFEQRM LDVCGGKEIG NDRPSEATTL NSTKNGNNST  240
SHDLSWKNFQ AFPPQSHHFP GVLGLILQRH FILWGCTRAS PWTVPWLSPP PSSASPTLGK  300
HSRDESTLNP SNLGKEDTFQ DKDGKKSVVI PKTLRIDDLD EAAKSSSTLG IKNDSANGAR  360
LFKAFNSKVD E
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016572747.10.0PREDICTED: cyclic dof factor 3-like
SwissprotQ93ZL59e-70CDF2_ARATH; Cyclic dof factor 2
TrEMBLA0A068TWC91e-120A0A068TWC9_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000473701e-117(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-68cycling DOF factor 2