PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01116.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 213aa    MW: 23505 Da    PI: 9.842
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01116.1_g00006.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.73.9e-26254254
                  G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                             prlrW+ +LH +F++av +LGG e+AtPk ile+m+vkgLtl+h+kSHLQ  R
  Sme2.5_01116.1_g00006.1  2 PRLRWSYKLHCSFLDAVGRLGGLERATPKMILEIMHVKGLTLSHIKSHLQLCR 54
                             8*************************************************877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-22154IPR009057Homeodomain-like
SuperFamilySSF466897.88E-11254IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-20256IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MPRLRWSYKL HCSFLDAVGR LGGLERATPK MILEIMHVKG LTLSHIKSHL QLCRNGKTDP  60
PMQDEAEAAN ANGIKKNIMA SPYQMNHPNG TLLPCYYNFS RKSAFDGHPN STLTTNYLGQ  120
ISPTPNIFPL APWKPVPEKM MMLDGRSDPS GKMFRDFFNG STSIQGGDGN TMFGANGRSF  180
STKNTSSTII KEDLPVSLEL SLSSPISLKL TLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-15357458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-15357458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-16357357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-16357357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-16357357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-16357357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-15357458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-15357458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-15357458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-15357458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-15357458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-15357458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015164536.19e-67PREDICTED: transcription repressor KAN1-like
TrEMBLA0A2G2VBP51e-56A0A2G2VBP5_CAPBA; Putative transcription factor RL9
TrEMBLA0A2G3D7642e-56A0A2G3D764_CAPCH; Putative transcription factor RL9
STRINGSolyc02g080860.1.11e-57(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74502029
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.12e-21G2-like family protein