PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01077.1_g00017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 269aa    MW: 30486.2 Da    PI: 8.4058
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01077.1_g00017.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.93.4e-19196229134
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                              C++Cg+ kTp+WR gp g+k+LCnaCG++y++ +
  Sme2.5_01077.1_g00017.1 196 CQHCGVDKTPQWRAGPTGPKMLCNACGVRYKSGR 229
                              *******************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.453190226IPR000679Zinc finger, GATA-type
SMARTSM004017.7E-16190245IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.95E-14192258No hitNo description
Gene3DG3DSA:3.30.50.106.3E-15193228IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.56E-15195248No hitNo description
PROSITE patternPS003440196221IPR000679Zinc finger, GATA-type
PfamPF003204.6E-17196229IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MDSTTCFMVD DDILNFSLDD DEKYQTSSSS FESSNVLGFL QDDHSRSFPV RHWLAARTSV  60
NIGCILQDFV EEELEWLSNK DAFPAVEFEI FSDHVPNVIF DHHSPDSVLE NNSTSSNSCN  120
TNVNESAFTS HTSSVLQVPV NYPVRPRSKR RRRRIALQSD NSCVWGNQVK FKQGLALLSI  180
PITKAKRPPS TIGRRCQHCG VDKTPQWRAG PTGPKMLCNA CGVRYKSGRY KSGRLFPEYR  240
PANSPTFSAD LHSNSHRKVL EMRKQRIVE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148153KRRRRR
2148154KRRRRRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355741.11e-123PREDICTED: GATA transcription factor 1-like
TrEMBLM1CLA01e-123M1CLA0_SOLTU; Uncharacterized protein
STRINGSolyc05g053500.2.11e-119(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40762445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.11e-38GATA transcription factor 1