PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00984.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 456aa    MW: 51028.4 Da    PI: 8.1735
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00984.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.5e-32259312255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Sme2.5_00984.1_g00002.1 259 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 312
                              9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15256312IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28257312IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23259312IPR006447Myb domain, plants
PfamPF002498.5E-7260311IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MPLEGVFIET PSSSTKPIPD LSLNISPPNS LDLSGRRCVT KVSENHERLL SEFSKTGNCL  60
TELSLAHPTN TITTTTTTVT NAIINDDMTT RRGFLDHLPR NSYYNNHHHH YHHQHQSQNY  120
SHMLQPMNQL NHGVSSLDVS DGLRPIKGIP VYNHNRSFPF LATNLDKEKD PKMCFYPSSS  180
PPSSSPSPSS PYFNSRFNGI SSSSYHVPHH LQYHHHHHSQ YGHVGGLGHP HHENIANSHS  240
LMRSRFLPKL QAKRSVRAPR MRWTSTLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL  300
AHVKSHLQMY RTVKTTDKPA VSSGQSDGSG EDDLTTIGST SGGDRAGLNR FMDQRGGSDE  360
SLQPESDYPS ITTPTLWSNS SSTREGWLQA NSNDANGLMR SHSFPSQQRS GHHIEECNSS  420
RPKSYNIGSN MDHKKNPSLE FTLGRPDWIE KDHESS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-16260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-16260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-16260314357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-16260314357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-16260314357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-16260314357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-16260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-16260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-16260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-16260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-16260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-16260314458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006352401.10.0PREDICTED: transcription repressor KAN1-like isoform X1
TrEMBLA0A0V0IFG90.0A0A0V0IFG9_SOLCH; Putative transcription repressor KAN1-like
STRINGPGSC0003DMT4000346630.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-60G2-like family protein