PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00813.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ZF-HD
Protein Properties Length: 297aa    MW: 33546.3 Da    PI: 8.1068
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00813.1_g00012.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.53.3e-3393149360
              ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                              +vrYkeClkNhAa++Gg+++DGCgEfmps geegt++ lkCaAC+CHRnFHR+e+e+e
  Sme2.5_00813.1_g00012.1  93 SVRYKECLKNHAANMGGYVLDGCGEFMPS-GEEGTPEYLKCAACDCHRNFHRKETEDE 149
                              69**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2093147IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.5E-3194146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.1E-3095145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.52296145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.3E-30228295IPR009057Homeodomain-like
SuperFamilySSF466893.86E-19228294IPR009057Homeodomain-like
PROSITE profilePS500718.875231295IPR001356Homeobox domain
TIGRFAMsTIGR015651.4E-26233290IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MEHGGQENDM GMPNPMGYNP SHLNQQESST SAANKFPTVP IASDRRTNQQ IIPENTIFSP  60
NQTLDQHNLT QNSDPDPVRQ LSTSSPSDRN IASVRYKECL KNHAANMGGY VLDGCGEFMP  120
SGEEGTPEYL KCAACDCHRN FHRKETEDES QTPGVHRNNH RILAQTPPSL PVAPTQHQHH  180
HKYSYSYARG HIAPVMMNFG GNTGVPAESS SEDLNMLHGG QGIIQPCNFS GSRKRFRTKF  240
SQQQKDRMQE FAEKLGWRIQ KQDDQEVQQF CNEVGVKRQV FKVWMHNSKQ AIKKKQT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-222342891873ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340630.10.0PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW73e-66ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLM0ZVH10.0M0ZVH1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000090330.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-67homeobox protein 24