PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00727.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 499aa    MW: 54663.8 Da    PI: 5.7384
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00727.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.11.9e-33227281155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              kpr+rWtpeLHe Fveav++LGGsekAtPk +l+lm+v++Lt++hvkSHLQkYR+
  Sme2.5_00727.1_g00005.1 227 KPRMRWTPELHEVFVEAVNKLGGSEKATPKGVLKLMNVESLTIYHVKSHLQKYRT 281
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.351224284IPR017930Myb domain
SuperFamilySSF466892.87E-18225281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-31225283IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-25227281IPR006447Myb domain, plants
PfamPF002491.7E-9229280IPR001005SANT/Myb domain
PfamPF143792.8E-8314335IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MDVSGAMPMS LPSLPKLEEK FPKLPDSVHV ISEKELTTNL TFPRAVSSMS KSGTVGHLLS  60
STSGHHKDFH FSPPSSQETR TCHYPFISSG ASIAASQASK LSVHSTSLDN YPLGSNPKSW  120
GKDSFHEFLS FPTNVPVENG QVESLAGVLA SDDHAKRSDW QEWADQLIND DDTLGSSWND  180
ILVDINFPDP EPKLLGGSEI PANQLQPPPP TAGQSCPVGS PSSAASKPRM RWTPELHEVF  240
VEAVNKLGGS EKATPKGVLK LMNVESLTIY HVKSHLQKYR TARYKPESSE GTSERKPTVV  300
AEMPSLDLKT TKGITEALKM QMEVQKQLHE QLEEQSYSGQ SGSGLPSGQD EGGELRWFRH  360
VKRRCTDAPM RKCERSTENA DGSAETASCM RIEEQGKYLQ MMFEKTKNMG KELSVSSSKS  420
DEPPSPFTAP PDDKSDAPEQ DHVSIELSSN VASSSANVLT ENKEQKSPER KACEDHDSDG  480
RDLRFPPAKR AKSEETSPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-29227285260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-29227285260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-29227285260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-29227285260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-29227285260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-29227285260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-29227285260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-29227285260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754431e-179HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340463.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A0V0ICE00.0A0A0V0ICE0_SOLCH; Uncharacterized protein
STRINGXP_009593796.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45822139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.12e-68phosphate starvation response 1