PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00726.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 600aa    MW: 66537.3 Da    PI: 5.1911
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00726.1_g00016.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.85.8e-34249303155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              k+r+rWtpeLHe+Fveav++LGGse+AtPk +l++mkv+gLt++hvkSHLQkYR+
  Sme2.5_00726.1_g00016.1 249 KQRMRWTPELHEAFVEAVNKLGGSERATPKGVLKMMKVEGLTIYHVKSHLQKYRT 303
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.736246306IPR017930Myb domain
SuperFamilySSF466897.88E-18247303IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-31248305IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-25249303IPR006447Myb domain, plants
PfamPF002491.7E-10251302IPR001005SANT/Myb domain
PfamPF143791.1E-25487534IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MEARPAVSVQ NVVASQLSNC GASGALSSSM SIFPTALGEK YPKFPDLQQA SMEKELKQHP  60
GTVVSSLPSN SGAVGLMFSS SSGFSADLHS SSVSSQEKHS GPAPFISQST YSETSMLLPH  120
SGVLQPTASS EYLNEHEPWC IDPLPNFLDY PMNTPVQNSQ VACSNRQSDW QGWADLVIND  180
EDDLTSNWND IMADTSIGNS EMKMQDQEEK HPLNFPMQQV QASQPIPAVP VETSAIAPVS  240
SPASSAATKQ RMRWTPELHE AFVEAVNKLG GSERATPKGV LKMMKVEGLT IYHVKSHLQK  300
YRTARYKPEA LEGSSEKKQS SLDDLSSLDL KTINSLPQAA VSLYRLVSIE NLPVFSSSTK  360
ITDYQIWWKG QLEFPVIRGW PTVIPESPLH RHLLFLFLAL LDSPFSMLIF DMLSTTSEEL  420
RLASMVALVM IWSGFGDRNF RCWFCGLGHG SDKDFGTLIF SVLVDNVFRL CECLNLVGFG  480
CRHRRGIEIT EALRLQMEVQ KRLHEQLEIQ RNLQLRIEEQ GRYLQMMFEK QCKSMPGADL  540
TKGSSSSTAD DAFAQLSQVD AAKEVDEKQK ERETEVLGAP ETNITSTSDS PPLKRSKLDE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-32249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-32249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-32249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-32249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-32249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-32249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-32249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-32249307260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015088022.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
RefseqXP_015088023.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
RefseqXP_015088024.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
RefseqXP_015088025.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
RefseqXP_015088026.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
RefseqXP_015088028.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
TrEMBLA0A1U7WMW60.0A0A1U7WMW6_NICSY; protein PHR1-LIKE 1-like isoform X1
STRINGSolyc09g072830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-51phosphate starvation response 1