PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00720.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Dof
Protein Properties Length: 305aa    MW: 33223.5 Da    PI: 9.6107
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00720.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.75.3e-383793561
                   zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                              +kcprCds+ntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rk k++
  Sme2.5_00720.1_g00003.1 37 PQKCPRCDSNNTKFCYYNNYSLTQPRYFCKTCRRYWTQGGTLRNVPVGGGCRKGKRT 93
                             689**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.8633892IPR003851Zinc finger, Dof-type
PfamPF027012.8E-323892IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-243992IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MEEQLGGRSS GENDRNQQQR RMKMPENMTS APPQPPPQKC PRCDSNNTKF CYYNNYSLTQ  60
PRYFCKTCRR YWTQGGTLRN VPVGGGCRKG KRTMKGGGLS SSAGESSSRS HHHHHQVLQS  120
PPIANLSTAT FFSGNNSRSQ PLPMSSLYTG GGGGLLSSLA AMQSMSQLSQ SIINQSPLGV  180
ISGSNNNNNN QLIGNFNIPT STSPKVPMNQ QLENTGFYQM VNSEKPNMES SFYPSDQTLQ  240
FQPTRPLGSW TQRFINSNNN NNNNIWPNSS ADNSSSGGAN DSTTADVASL SPNQWPDLPG  300
FGPSP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010316760.11e-118PREDICTED: dof zinc finger protein DOF5.3-like
RefseqXP_010316761.11e-118PREDICTED: dof zinc finger protein DOF5.3-like
RefseqXP_010316762.11e-118PREDICTED: dof zinc finger protein DOF5.3-like
TrEMBLK4B9211e-118K4B921_SOLLC; Uncharacterized protein
STRINGSolyc02g077960.1.11e-118(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.17e-33TARGET OF MONOPTEROS 6