PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00720.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Dof
Protein Properties Length: 391aa    MW: 42895.4 Da    PI: 7.4458
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00720.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.73e-3953113262
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              ++++lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ +
  Sme2.5_00720.1_g00002.1  53 QQQHLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRIK 113
                              6899******************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3052111IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3355111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52557111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MVGECEKMVL ISSSTTNQIW PQIDEKNNLT MAANGTINTT RDMEKPIQDP SQQQQHLKCP  60
RCDSSNTKFC YYNNYSLSQP RHFCKACKRY WTRGGTLRNV PVGGGCRKNK RIKRSSANSS  120
SSTTTTTISH DIITTSTPNA NPSHHHQLHG VHNSNIDHLS TTNSPSHLNS LFYGLTNERS  180
DLNIPFARLF NSRVSSHAGG VDEGQVYSLT DGIAGLMDRR IGLGFSNSSG GVVSMGENNN  240
YGHGGFNPIK QIQDVHVMSN SNCTTSTTSL LSSYPNMFGS SPSTSTMASL IASSLQQQKF  300
MSNIHGNTFH NLLAPNYEEL QMSRGDNNNN DNSTLHEGGE NGITMLKEEK MDLSNQQIHE  360
QIINSSDPSL SWNGAWLDPS NMGSNSVPSL I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015063472.10.0PREDICTED: dof zinc finger protein DOF1.4
TrEMBLM1CWS80.0M1CWS8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000764470.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.11e-35Dof family protein