PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00669.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ZF-HD
Protein Properties Length: 85aa    MW: 9354.45 Da    PI: 8.7864
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00669.1_g00014.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1049.4e-332176258
              ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                             +++rY eC++NhAa++Gg+avDGC+Efm+s ge+gt aal+CaACgCHRnFHRrev+
  Sme2.5_00669.1_g00014.1 21 RNIRYVECQRNHAANIGGYAVDGCREFMAS-GEDGTNAALTCAACGCHRNFHRREVD 76
                             579**************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-23283IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.7E-312375IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.5E-272475IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.7142574IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048509Biological Processregulation of meristem development
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MMKKRQVVVR RNTSGSSTRA RNIRYVECQR NHAANIGGYA VDGCREFMAS GEDGTNAALT  60
CAACGCHRNF HRREVDGGEV VSESF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016567575.18e-49PREDICTED: uncharacterized protein LOC107865897
RefseqXP_016567576.18e-49PREDICTED: uncharacterized protein LOC107865897
SwissprotQ2Q4934e-34MIF3_ARATH; Mini zinc finger protein 3
TrEMBLM1BQ293e-47M1BQ29_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000502868e-47(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18835.12e-35mini zinc finger