PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00661.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 387aa    MW: 44313.3 Da    PI: 6.9834
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00661.1_g00008.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.83.6e-52151431128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd++   ++ +  +++wyfFs++dkky+tg+r+nrat++g+W
  Sme2.5_00661.1_g00008.1  15 VPPGFRFHPTEEELLHYYLRKKVAYEKIDL-DVIRDVDLNKLEPWDIQDkcRIGStPQNDWYFFSHKDKKYPTGTRTNRATTAGFW 99 
                              69****************************.9***************952433332456*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk ++s +++ +g++ktLvfykgrap+g+k+dW+mheyrl
  Sme2.5_00661.1_g00008.1 100 KATGRDKVIHS-NSKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 143
                              *********99.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5811173IPR003441NAC domain
PROSITE profilePS5100556.57815173IPR003441NAC domain
PfamPF023651.5E-2716143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MSKDMNLSVN GQSQVPPGFR FHPTEEELLH YYLRKKVAYE KIDLDVIRDV DLNKLEPWDI  60
QDKCRIGSTP QNDWYFFSHK DKKYPTGTRT NRATTAGFWK ATGRDKVIHS NSKRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDDNIDIP LKTNANESSN QEEGWVVCRV FKKKNYHKAL  180
ESPQSSSSAL SRSSALIQKP NNDAVLDQIL MYMGRSCKQQ DLESKHNNSL LNNIHLDDHI  240
MQINNTNSFM INNNVNRFIH LPGLDNHHSP TNNMEDVSSL QLIQQADCCS FDETLTETHP  300
KSGLGEMRWS HTSTGSGPSD WASLDRLVAS QLNGHDHVEN ISSNNNLCFP LHHHRKPNDD  360
DDVDVEFWSY ARSSSPSPSD PLCHLSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-491217514167NO APICAL MERISTEM PROTEIN
1ut4_B2e-491217514167NO APICAL MERISTEM PROTEIN
1ut7_A2e-491217514167NO APICAL MERISTEM PROTEIN
1ut7_B2e-491217514167NO APICAL MERISTEM PROTEIN
3swm_A2e-491217517170NAC domain-containing protein 19
3swm_B2e-491217517170NAC domain-containing protein 19
3swm_C2e-491217517170NAC domain-containing protein 19
3swm_D2e-491217517170NAC domain-containing protein 19
3swp_A2e-491217517170NAC domain-containing protein 19
3swp_B2e-491217517170NAC domain-containing protein 19
3swp_C2e-491217517170NAC domain-containing protein 19
3swp_D2e-491217517170NAC domain-containing protein 19
4dul_A2e-491217514167NAC domain-containing protein 19
4dul_B2e-491217514167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016565041.10.0PREDICTED: NAC domain-containing protein 43-like
RefseqXP_016565056.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-117NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A2G2XJT80.0A0A2G2XJT8_CAPBA; NAC domain-containing protein 66
STRINGXP_009607557.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-104NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]