PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00641.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 350aa    MW: 39410 Da    PI: 7.4956
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00641.1_g00007.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62e-52141391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrF Ptdeel+v+yL++kv+g++++l ++i+evd+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkat
  Sme2.5_00641.1_g00007.1  14 LPPGFRFYPTDEELLVQYLCRKVAGDDFSL-QIIAEVDLYKFNPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKAT 98 
                              79***************************9.89***************7777799******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk ++s +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Sme2.5_00641.1_g00007.1  99 GTDKVITS-EGRKVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                              *******9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-659163IPR003441NAC domain
PROSITE profilePS5100560.03514163IPR003441NAC domain
PfamPF023654.0E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGVRETDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGDD FSLQIIAEVD LYKFNPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITSEGRK VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLS VPTTKSGSSS RLDDWVLCRI YKKNCPVQKA CSSDMQSKEM  180
SHGSSSSSSS QFDSMLEPLP EDRYFSLPTR NFQQDDNKLN LQQPSSENFD WATWGGFNSF  240
PELTTGNQAP AQVNQTPMLV NINQNHNNNN NMNNFTEFFA NPTALNFHGE VKFEGGVDQE  300
VESSVRAQRM NSVNPGFFPE NSTGFSHASS VPDPFGIRYP TQTVNMGFSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10511694171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10511694171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10511694171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10511694171NO APICAL MERISTEM PROTEIN
4dul_A1e-10511694171NAC domain-containing protein 19
4dul_B1e-10511694171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001306107.10.0JA2-like
RefseqXP_015081066.10.0NAC domain-containing protein 72-like
SwissprotA0A3Q7HH640.0JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLM1BP490.0M1BP49_SOLTU; Uncharacterized protein
STRINGSolyc07g063410.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-110NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  3. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]