PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00622.1_g00024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 364aa    MW: 41012.4 Da    PI: 9.3962
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00622.1_g00024.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.5e-32208262155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              k+r+rWt++LH+rFve+v++LGG++kAtPk+il+lm+ +gLt+ hvkSHLQkYR 
  Sme2.5_00622.1_g00024.1 208 KTRIRWTQDLHDRFVECVNRLGGADKATPKAILKLMDSEGLTIFHVKSHLQKYRN 262
                              68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.614205265IPR017930Myb domain
SuperFamilySSF466898.6E-17206262IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28206263IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-24208263IPR006447Myb domain, plants
PfamPF002492.6E-8212261IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGFCFQPENS AQNGCQQQQQ QQQNIWPSTD SSSSRTIISR IGSSPSAFFA TERYLGLTQY  60
EYQDNNSCTQ LSKNLDPQNP SFTQQCGNGF LENSSARVDT DFPKISMPSF IRSQFSNSQP  120
LGSEGLYENP YSNLSEKERI LLLKSKLFRE IDSSNRQPAS VPFQRNQDSG VSNNTSGFNL  180
VHIKQQSGSQ SATSFNNSSC SGGPLSSKTR IRWTQDLHDR FVECVNRLGG ADKATPKAIL  240
KLMDSEGLTI FHVKSHLQKY RNAKFIPEST EGRSGKTDSP NNVTQMILKI RRLLSNVEMV  300
SWKIHQHELT PIFPRFDRQQ NWNANQRSTA YATRSPEAPS RATRDSAKVT TEDRRTRGAI  360
EEDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-22208265158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-22208265158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-22208265158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-22208265158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249167.11e-168myb family transcription factor PHL5-like
RefseqXP_015089588.11e-168myb family transcription factor PHL5
TrEMBLA0A3Q7IKJ31e-167A0A3Q7IKJ3_SOLLC; Uncharacterized protein
STRINGSolyc10g078720.1.11e-168(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.28e-37G2-like family protein