PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00601.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NF-YC
Protein Properties Length: 178aa    MW: 19408.4 Da    PI: 6.5076
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00601.1_g00018.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC78.87.2e-2517626101
                    NF-YC  26 ikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                              +k+i+k++ dv ++saeaP+ll kacel+  eltl s lh ++n+r+ l+k d+ +av +t+ fdflv i prde+
  Sme2.5_00601.1_g00018.1   1 MKRIMKSNLDVLKVSAEAPNLLVKACELLTGELTLHSRLHIQSNQRQLLHKKDMVDAVRQTEAFDFLVKILPRDEI 76 
                              59***********************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008081.8E-7158IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.8E-17173IPR009072Histone-fold
SuperFamilySSF471133.67E-15282IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MKRIMKSNLD VLKVSAEAPN LLVKACELLT GELTLHSRLH IQSNQRQLLH KKDMVDAVRQ  60
TEAFDFLVKI LPRDEINEGA TGFGPGMVGS TVSDVPNSYP PMGQPVVPGV ITGNPAMLVV  120
APSMCVHPWL QAWEAVENYP YATGGNNGQG NHDPPSGMME PPRLIGYRMI DMLHGNLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_B2e-171732395NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006351509.16e-53PREDICTED: nuclear transcription factor Y subunit C-1-like isoform X2
RefseqXP_015166000.17e-53PREDICTED: nuclear transcription factor Y subunit C-1-like isoform X3
TrEMBLM1B8B61e-51M1B8B6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000394702e-52(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40872143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.11e-37nuclear factor Y, subunit C1