PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00595.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ERF
Protein Properties Length: 143aa    MW: 16252.2 Da    PI: 9.1381
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00595.1_g00010.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP262.78.2e-20860256
                      AP2  2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56
                             +y+GVr+++ +g+++AeIrdp+++  + r +lg+f+taeeAa+a+++a  +l+g+
  Sme2.5_00595.1_g00010.1  8 KYRGVRRRP-WGKFAAEIRDPTTRP-SSRQWLGTFDTAEEAARAYDKASFNLRGH 60
                             8********.**********98833.49*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000186.78E-31868No hitNo description
PfamPF008471.2E-13860IPR001471AP2/ERF domain
SuperFamilySSF541712.09E-21868IPR016177DNA-binding domain
Gene3DG3DSA:3.30.730.101.7E-29869IPR001471AP2/ERF domain
SMARTSM003805.9E-34873IPR001471AP2/ERF domain
PROSITE profilePS5103223.881867IPR001471AP2/ERF domain
PRINTSPR003673.3E-11920IPR001471AP2/ERF domain
PRINTSPR003673.3E-113349IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MQEKEEVKYR GVRRRPWGKF AAEIRDPTTR PSSRQWLGTF DTAEEAARAY DKASFNLRGH  60
LATLNFPNEY YNQLPCPPLY YDNSICSSKN NVTSNNIPRG KGSSSTSPTN KLAREVIELP  120
CLDNSVLEEL LGAEDPKRVT KRN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5wx9_A3e-275701175Ethylene-responsive transcription factor ERF096
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006354547.13e-84PREDICTED: ethylene-responsive transcription factor ERF098-like
SwissprotQ9LTC54e-38ERF98_ARATH; Ethylene-responsive transcription factor ERF098
TrEMBLM1DZV11e-82M1DZV1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000970752e-83(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21241165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23230.12e-40ERF family protein
Publications ? help Back to Top
  1. Van den Broeck L, et al.
    From network to phenotype: the dynamic wiring of an Arabidopsis transcriptional network induced by osmotic stress.
    Mol. Syst. Biol., 2017. 13(12): p. 961
    [PMID:29269383]