PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00579.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 182aa    MW: 20042.3 Da    PI: 6.2405
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00579.1_g00009.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.11.7e-32457255
                  G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             pr+rWt++LH+rFv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Sme2.5_00579.1_g00009.1  4 PRMRWTSTLHARFVHAVDLLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 57
                             9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.587160IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-29257IPR009057Homeodomain-like
SuperFamilySSF466891.4E-15258IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-24457IPR006447Myb domain, plants
PfamPF002497.1E-7556IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MRAPRMRWTS TLHARFVHAV DLLGGHERAT PKSVLELMDV KDLTLAHVKS HLQMYRTVKT  60
TDKSAAGAAS SGQSEVFDNV SSGDNSDDLV LEIQNAKLSI QQGRQNMDNQ EKDYGGLWSN  120
SSSKESWQLH GKLEDYPGNL PSLEKDMEAK CTSYEGISTE VSSSSITQAS PKKPNLDFTL  180
GI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-18559458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-18559458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-18559458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-18559458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-18559458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-18559458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-18559458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-18559458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0109394e-47AP010939.1 Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0175O15, complete sequence.
GenBankHG9754474e-47HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankHG9755204e-47HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015083820.11e-122probable transcription factor KAN2 isoform X1
SwissprotQ9C6166e-60KAN2_ARATH; Probable transcription factor KAN2
TrEMBLM1BKY11e-120M1BKY1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000475321e-120(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.13e-56G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]