PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00507.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 278aa    MW: 30801.7 Da    PI: 8.1071
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00507.1_g00010.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.69.4e-20195229135
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                              C++Cg+ kTp+WR gp g+ktLCnaCG++y++ +l
  Sme2.5_00507.1_g00010.1 195 CQHCGADKTPQWRAGPLGPKTLCNACGVRYKSGRL 229
                              *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.136189225IPR000679Zinc finger, GATA-type
SMARTSM004016.4E-16189243IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.6E-15191252No hitNo description
Gene3DG3DSA:3.30.50.101.2E-14193227IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.25E-14194242No hitNo description
PROSITE patternPS003440195220IPR000679Zinc finger, GATA-type
PfamPF003202.3E-17195229IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MKMEDLDPTS CFMVDDDLLD FSLEDETLEE DDEKSTVTSK DSLPYSSSSS TNPPLNLLPH  60
PECVEEELEW LSNKDAFPAI EFGILADNPG MVFDHHSPVS VLENSSSTSQ SSGNGVANRN  120
AYTSCCVNLK VPVNYPVRAR SKRRRRRRRG GFADISSEHC LPVNQPSFKN IKLREPWLPL  180
QKNSAKSVAS IGRKCQHCGA DKTPQWRAGP LGPKTLCNAC GVRYKSGRLL PEYRPANSPT  240
FSAASHSNSH RKVLEMRKHK IGVGGMLIHE ACGYRVGQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139148RSKRRRRRRR
2141146KRRRRR
3142148RRRRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010326807.11e-161PREDICTED: GATA transcription factor 1
SwissprotQ8LAU91e-43GATA1_ARATH; GATA transcription factor 1
TrEMBLA0A0V0I6M71e-159A0A0V0I6M7_SOLCH; Putative GATA transcription factor 1-like
STRINGPGSC0003DMT4000302741e-158(Solanum tuberosum)
STRINGSolyc09g091250.2.11e-157(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40762445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.19e-41GATA transcription factor 1