PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00386.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family bHLH
Protein Properties Length: 92aa    MW: 10430.7 Da    PI: 8.5287
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00386.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH31.43.3e-1020601454
                             HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                      HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                             d+iN+  ++L++llP++ + +s K+s + +L+++++YIksL
  Sme2.5_00386.1_g00001.1 20 DQINDLVSKLQQLLPELRNRSSDKVSASRVLQETCNYIKSL 60
                             79**************8799********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088812.125660IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.5E-72060IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.3E-102079IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.105.8E-102076IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0010086Biological Processembryonic root morphogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MSSRRSRSSR HSGGSRISED QINDLVSKLQ QLLPELRNRS SDKVSASRVL QETCNYIKSL  60
HREVDDLSDR LSELLESSDT TQAALLRSLL MQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755186e-60HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
GenBankHG9754456e-60HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241574.12e-44PREDICTED: transcription factor PRE3
RefseqXP_006354787.12e-44PREDICTED: transcription factor PRE3-like
RefseqXP_015078920.12e-44PREDICTED: transcription factor PRE3-like
SwissprotF4JCN96e-37PRE4_ARATH; Transcription factor PRE4
SwissprotQ9CA645e-37PRE3_ARATH; Transcription factor PRE3
TrEMBLK4C8G42e-44K4C8G4_SOLLC; Uncharacterized protein
STRINGSolyc06g070910.2.15e-44(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35324161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74500.13e-26activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1