PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00378.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 416aa    MW: 47178.8 Da    PI: 7.7439
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00378.1_g00015.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.41.5e-334498155
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             kprl+Wtp+LHerF+eav+qLGG++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
  Sme2.5_00378.1_g00015.1 44 KPRLKWTPDLHERFIEAVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 98
                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3841101IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-314299IPR009057Homeodomain-like
SuperFamilySSF466899.14E-174399IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-244499IPR006447Myb domain, plants
PfamPF002492.5E-104697IPR001005SANT/Myb domain
PfamPF143792.5E-23144191IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MYHHHHQDKS MHTSTRMSIP ERHLFLQGGN GNGDSGLVLS TDAKPRLKWT PDLHERFIEA  60
VNQLGGADKA TPKSVLKLMG IQGLTLYHLK SHLQKYRLSK NLHGQANASG ANKAVAATGV  120
ERISENSATC MSNPSMVTQP NKNIQISEAI QMQIEVQRRL HQQLEVQRHL QLRIEAQGKY  180
LQSVLEKAQE TLGRQNMETV GLEAVKVQLS EFVSKASNQC LKSAFPDIKE LSGFHRQQTQ  240
ATQPADRSID SCLTSREGSL RDNTLHDNQI GLRPFDFTPS IECKDIENDT RLQQTDLRWC  300
DNLKENRRLF YPMNEGSEKT FTQETNYSNL SMSIGLQDEK LNGSMIHSDG NFNGTDRNVK  360
LFHQVANRSE SVPERQKSTQ DYKLSYFEPK LDLNMHDEPD AASSRKQFDL NGFSWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-2244100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-2244100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-2244100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-2244100157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may act on the GAL1 promoter (PubMed:12008900). Acts redundantly with MYR2 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:12008900}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2449200.0AC244920.2 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone sle-6e17 map 10, complete sequence.
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010312321.10.0myb-related protein 2 isoform X1
RefseqXP_010312322.10.0myb-related protein 2 isoform X1
SwissprotQ9FK471e-129PHLA_ARATH; Myb-related protein 1
TrEMBLA0A3Q7IMN90.0A0A3Q7IMN9_SOLLC; Uncharacterized protein
STRINGPGSC0003DMT4000216530.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.41e-128myb-related protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]