PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00372.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 354aa    MW: 38363.9 Da    PI: 6.1237
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00372.1_g00006.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.37.9e-17244278135
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                              C +C + kTp+WR gp g+ktLCnaCG++y++ +l
  Sme2.5_00372.1_g00006.1 244 CLHCASDKTPQWRTGPFGPKTLCNACGVRYKSGRL 278
                              99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.2E-7616333IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.334238274IPR000679Zinc finger, GATA-type
SMARTSM004013.5E-15238288IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.98E-15240302No hitNo description
Gene3DG3DSA:3.30.50.103.0E-13240275IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.58E-14243294No hitNo description
PROSITE patternPS003440244269IPR000679Zinc finger, GATA-type
PfamPF003203.8E-15244278IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MEASDFFISG FFSHAGDGDE QNPNNNNNNN NNGNNFSVDD LLDIPKEDEA MEDAFFNSIT  60
GNSADSSTVT VVDSCNSSVS GGDGHFNGNM SSRSFSNDPF TNNELCVQFE DLAELEWLSN  120
FVEESSSFSS EEVPNLQFIP LANIASGINT TDSSSSATTI STGANSPPAF PADTSVPGKA  180
RSKRSRAAPC DWSSRLQLLL SPATSSSESN NVSANSTTLT TPTAKSTKAP SKKRESVETP  240
GRKCLHCASD KTPQWRTGPF GPKTLCNACG VRYKSGRLVP EYRPASSPTF ISAKHSNSHR  300
KVLELRRQKD LQRHQALQQH QLLNQPAIFG VSNGGDEFLL HHHQNCGPNF RHII
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015067847.10.0GATA transcription factor 12-like
SwissprotP697815e-72GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A0V0HX750.0A0A0V0HX75_SOLCH; GATA transcription factor
STRINGSolyc03g120890.2.10.0(Solanum lycopersicum)
STRINGXP_009628152.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19192363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.14e-58GATA transcription factor 12
Publications ? help Back to Top
  1. Ravindran P,Verma V,Stamm P,Kumar PP
    A Novel RGL2-DOF6 Complex Contributes to Primary Seed Dormancy in Arabidopsis thaliana by Regulating a GATA Transcription Factor.
    Mol Plant, 2017. 10(10): p. 1307-1320
    [PMID:28917589]