PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00324.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 554aa    MW: 63597.8 Da    PI: 5.1873
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00324.1_g00009.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.52.1e-5661341129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeelv++yLk+k++g+k+el evi+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWk
  Sme2.5_00324.1_g00009.1   6 LPPGFRFHPTDEELVSYYLKRKINGRKIEL-EVIPEVDLYKCEPWDLPdKsLLPSKDMEWYFFSPRDRKYPNGTRTNRATKAGYWK 90 
                              79****************************.99**************96435566888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              atgkd++v s + + +g+kktLv+y+grap+g++t Wvmheyrle
  Sme2.5_00324.1_g00009.1  91 ATGKDRKVNS-QMRPIGMKKTLVYYRGRAPHGTRTGWVMHEYRLE 134
                              *********9.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-634156IPR003441NAC domain
PROSITE profilePS5100561.6556156IPR003441NAC domain
PfamPF023653.3E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV SYYLKRKING RKIELEVIPE VDLYKCEPWD LPDKSLLPSK  60
DMEWYFFSPR DRKYPNGTRT NRATKAGYWK ATGKDRKVNS QMRPIGMKKT LVYYRGRAPH  120
GTRTGWVMHE YRLEERECEV ANGLQDAYAL CRVFKKSLNA VKIGDHYGSD RSGCSINDQL  180
YTEDSDYGMP TTASSSMLHH ASLPLTDDNK WMQYLSDEPN FTCNNNPTNA PFPYNHPSKV  240
DIALECARLQ HRFALPPLEV HDFPQVGYVM SQSNDVMYDH QSTTNPTDIV QEILSVAQAS  300
HDLTNQEYSW DGNYNNINYG DDFSFLPHTH NNHDLGNSFN FMDQLKEDDD HNNSIPIAHF  360
DEDFKSESMV ERLRWVGVSQ KDDQTFFEDY KTVPVENISG PHKEEQDQLQ GEASGQQNNL  420
NEREENNFSL GFGNDEHLLD DEDTDGFSSS PSFEVYEKIE VNQGMFIATR QAANTFYLQV  480
APSKTVTIHR DLVKVHDFPI RKITKSATFL ETFMALSRKT LLGVVMRVNW RGTVNSLVEL  540
IAPLQTFWSI LGNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-55116212171NO APICAL MERISTEM PROTEIN
1ut4_B1e-55116212171NO APICAL MERISTEM PROTEIN
1ut7_A1e-55116212171NO APICAL MERISTEM PROTEIN
1ut7_B1e-55116212171NO APICAL MERISTEM PROTEIN
3swm_A1e-55116215174NAC domain-containing protein 19
3swm_B1e-55116215174NAC domain-containing protein 19
3swm_C1e-55116215174NAC domain-containing protein 19
3swm_D1e-55116215174NAC domain-containing protein 19
3swp_A1e-55116215174NAC domain-containing protein 19
3swp_B1e-55116215174NAC domain-containing protein 19
3swp_C1e-55116215174NAC domain-containing protein 19
3swp_D1e-55116215174NAC domain-containing protein 19
4dul_A1e-55116212171NAC domain-containing protein 19
4dul_B1e-55116212171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2467410.0AC246741.6 Solanum lycopersicum strain Heinz 1706 chromosome 2 clone slm-55o9 map 2, complete sequence.
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015165583.10.0PREDICTED: NAC domain-containing protein 86-like
TrEMBLM1BXQ90.0M1BXQ9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000553220.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14952348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-146NAC domain containing protein 28