PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00281.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 518aa    MW: 58951 Da    PI: 9.8226
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00281.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA42.87.3e-14189223135
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                              Cs+Cg  +T +WRrgp  ++ LCnaCG ++r++g+
  Sme2.5_00281.1_g00001.1 189 CSHCGINQTRHWRRGPPEKPVLCNACGTRWRSRGT 223
                              ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.1E-9183238IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-10187227No hitNo description
CDDcd002025.77E-12188231No hitNo description
Gene3DG3DSA:3.30.50.101.9E-10189225IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011410.027189222IPR000679Zinc finger, GATA-type
PROSITE patternPS003440189214IPR000679Zinc finger, GATA-type
PfamPF003208.4E-12189223IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MAIHDILSTG TYKCRSMGQH CLQMLELLQT TQNYGFQVHQ NIRIKLRHAH QIINLSNQPR  60
SVFRKQPLYF YEVAARSRTP YPPQTPLVGF YWFTGHVAAL NLPSLNIEIF KRPWLTSQLR  120
KNNLPQQYRS SLDHNNKEIS PSNTDPPLTT RFTKSLDHMI EVIIIHLFSK ERTSCRQPIS  180
DLMARHGPCS HCGINQTRHW RRGPPEKPVL CNACGTRWRS RGTLEDYMPR HANRRMQKYQ  240
LLSEMTPCLR ARDGRKLEVG AEISGQNGSS ACLQEKTKSI PSLDSAGPSS INCMQTEETN  300
DKGPIVNPEN VPKRKRSKLT QSPMQRLQRR LYNNLQKPEF ENIPDGDEDV TLIYARNHCN  360
PTYEIGLGAM LLTSKSTTTG RSMSLSPIVE DSASFSMDVP VENPYWINNN VLDHVAMQNE  420
TTGNEDGKAN TREIRLGPHH LGTTSRVSSQ ELYSQRDAAQ IGTQVKRPRG RPRLSTNQVP  480
KTQMCLLPDK TSTPDVDWMQ SALRDLLYCI GKAKSNSH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1311318PKRKRSKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA125821014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.33e-20GATA transcription factor 26