PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00194.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 768aa    MW: 85708.7 Da    PI: 5.8949
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00194.1_g00016.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like72.18.3e-23199249152
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                              k r++Wtp++H++F++a++qL G ekA+Pk+i+e+m+ +gLt+ehv+SHLQ 
  Sme2.5_00194.1_g00016.1 199 KRRVVWTPKMHQNFLQAIQQL-GCEKAVPKKIVEIMNEPGLTREHVASHLQT 249
                              689******************.9****************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.85E-718139IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.3E-918158No hitNo description
Gene3DG3DSA:1.10.10.602.4E-22197250IPR009057Homeodomain-like
SuperFamilySSF466891.25E-15198254IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-22199253IPR006447Myb domain, plants
Gene3DG3DSA:3.40.50.1501.3E-51478694IPR029063S-adenosyl-L-methionine-dependent methyltransferase
SuperFamilySSF533357.55E-56493767IPR029063S-adenosyl-L-methionine-dependent methyltransferase
TIGRFAMsTIGR007551.7E-58495764IPR011530Ribosomal RNA adenine dimethylase
PROSITE profilePS5168961.441495768IPR001737Ribosomal RNA adenine methyltransferase KsgA/Erm
PfamPF003983.3E-42496765IPR001737Ribosomal RNA adenine methyltransferase KsgA/Erm
SMARTSM006506.8E-56509694IPR020598Ribosomal RNA adenine methylase transferase, N-terminal
PROSITE patternPS011310525552IPR020596Ribosomal RNA adenine methylase transferase, conserved site
CDDcd024400.00357525622No hitNo description
Gene3DG3DSA:1.10.8.1009.6E-16699767IPR023165rRNA adenine dimethylase-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000154Biological ProcessrRNA modification
GO:0009409Biological Processresponse to cold
GO:0000179Molecular FunctionrRNA (adenine-N6,N6-)-dimethyltransferase activity
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 768 aa     Download sequence    Send to blast
MDIQGVTANS SDMGTKNICM LIVLDDFTSH NFVCDMLHNQ THQVLHVGKT MDTLNAVWER  60
KSIFNLVLTN IHRLNTNGVD ILQIIKNKLN LPTILLSPDD TRYENQVQDC SVAAYVVSFS  120
DTNEMDKFWQ MVLEKEKGRK ATLNQEENAS TLPQDVTAET SRENTSSVDT DAAIRARDLK  180
GKQKANTERS EENRDIEKKR RVVWTPKMHQ NFLQAIQQLG CEKAVPKKIV EIMNEPGLTR  240
EHVASHLQTH FQQVNGGMNC PTSGQMGSFQ QQNSLLDLAN LQQADHSGLI GQHALFAPRL  300
AHNSNFRVYG DRRKNVLFSI ESVNENQPTN SNSGLEFLGF RLSTDGKSVN FGHKGSSCAV  360
IPNNSYSALC SSMSEDYTPQ QQSSPQFLET PIETTSLNKT SCQIPEMPDS FIPQEQLSAQ  420
PSSGDLEDYS AILFGEEVYV PSLENHDSIQ QEYSAPELPQ VTLEVKSFSE IRVNNKAEDD  480
YHATLKALNS KGRFPRKSLG QHYMLNSEVN DQLIAAADVQ EGDLVVEIGP GTGSLTNALV  540
NSGATVLAIE KDPYMAAIVM ERFSSLDCVK VLQEDFTKCH IRSHLSTVLQ SGRNSSGAKP  600
QYAKVVSNLP FNISTEVIKQ LLPMGDVFSE VVLLLQEEAA VRMVDSSLRS SEYRPINIFI  660
NFYSDPEYKF HVPRTNFFPQ PKVDAAVVSF RLKQPVDYPP VSSAKSFFSM VNCAFNGKRK  720
MLRKTLQHIC SSLEIEEALV SAGLPSTSRP EELSLNDFVR LHNLIVKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6ifs_A2e-3048476811290Ribosomal RNA small subunit methyltransferase A
6ifs_B2e-3048476811290Ribosomal RNA small subunit methyltransferase A
6ift_A2e-3048476811290Ribosomal RNA small subunit methyltransferase A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-146HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015168044.10.0PREDICTED: two-component response regulator ARR14-like
TrEMBLM1DH860.0M1DH86_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000890080.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA36591620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.14e-29response regulator 2