PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00186.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family bHLH
Protein Properties Length: 444aa    MW: 48861.2 Da    PI: 6.0565
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00186.1_g00004.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH41.22.9e-1373125155
                              CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                      HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                              ++ +hn+ Er RR++iN  ++ Lr+llP +  ++ kKls  +++ +  +YI +Lq
  Sme2.5_00186.1_g00004.1  73 KKLNHNASERDRRKKINGLYSSLRSLLPAS--EHTKKLSIPSTVSRMLKYIPELQ 125
                              6789*************************7..37777***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088813.71972124IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474595.76E-1572141IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.103.7E-1373140IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.2E-1073125IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000835.93E-1273129No hitNo description
SMARTSM003531.3E-878130IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:3.60.15.105.4E-15227302IPR001279Metallo-beta-lactamase
Gene3DG3DSA:3.60.15.107.4E-5324406IPR001279Metallo-beta-lactamase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MLAISSYSSP SNNFGWLLED VISHELTNSG ENSNPDIAIN SLSQKSLQHC DSNKFDQINI  60
NGGDHCQPDQ TVKKLNHNAS ERDRRKKING LYSSLRSLLP ASEHTKKLSI PSTVSRMLKY  120
IPELQSEVER LTQKKEQLTS TTIYNRENSA DFNKQKGRKG GIENSSLVIS TSGLGDNEIA  180
IQISTLKNNK GSIGEVISIL EDEGLDLLNA TSFETFEDRI FYTLHFQGLQ RFCMEHKIKL  240
SQVDHICLTR VCSETTGGLP GLLLTLAGMK DDSPGSPSVI HIWGPPNLDL LVNAMKTYVP  300
HGVMKNKNII SQSGSALAPE LRADGKFKAV HPDDVIGPPI PGPIVLIVDC PTEPHAQELL  360
SAQALEAYYS DSESNSTNVV NCIIHLSPST VVNSPVYGRW MRKFDILWKE LQAPSFPSVQ  420
NEDDGVVAPN IKESVEVCLL SSRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754491e-114HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016544540.11e-117PREDICTED: transcription factor ORG2-like
TrEMBLK4D2K61e-106K4D2K6_SOLLC; Uncharacterized protein
STRINGSolyc10g079650.1.11e-105(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22262256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.12e-41bHLH family protein