PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00175.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 326aa    MW: 36007.4 Da    PI: 6.8701
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00175.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.25.5e-19244277134
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                              C++C++ kTp+WR gp g+ktLCnaCG++y++ +
  Sme2.5_00175.1_g00001.1 244 CTHCQVQKTPQWRAGPLGPKTLCNACGVRYKSGR 277
                              *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.5E-815323IPR016679Transcription factor, GATA, plant
SuperFamilySSF577166.65E-15237300No hitNo description
PROSITE profilePS5011412.308238274IPR000679Zinc finger, GATA-type
SMARTSM004011.7E-14238288IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.4E-14241275IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.66E-13243300No hitNo description
PROSITE patternPS003440244269IPR000679Zinc finger, GATA-type
PfamPF003201.0E-16244277IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MELIEARALK SSFLSDMAMK NTQQVFLDDI WCVTGINNGG SEDFSVDDLL DFSDKDFKDP  60
ELHEDDEKTS FSGSSQKRNY SQDSTFSGME SFGSLDGQLP IPVDELENLE WLSQFVDDTS  120
SEFSLLYPAG SLKDKTGGFP EFRPEPVVRP VGKKMRVPCF PMPFPVKPRS KRARPAGRTW  180
SFPTSTVSGD SSSPTSSSYG SSPFPSGFFT NPVCDGDVFC SVEKPPLKKS KKNSSADTGS  240
GRRCTHCQVQ KTPQWRAGPL GPKTLCNACG VRYKSGRLFP EYRPACSPTF SMEVHSNSHR  300
KVLEMRRKKE TGELIDSGLA SMVSTC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015063162.10.0PREDICTED: GATA transcription factor 5
TrEMBLA0A0V0HYX80.0A0A0V0HYX8_SOLCH; Putative GATA transcription factor 5-like
STRINGSolyc01g110310.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11542481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-55GATA transcription factor 5