PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00151.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Dof
Protein Properties Length: 297aa    MW: 32940.5 Da    PI: 7.2489
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00151.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.86.6e-403494262
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             +++++kcprCdst+tkfCyynnysl+qPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  Sme2.5_00151.1_g00002.1 34 HDHSIKCPRCDSTHTKFCYYNNYSLTQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVS 94
                             57889*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-292888IPR003851Zinc finger, Dof-type
PfamPF027013.7E-333692IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9663892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MDSSSSPSGG DHINNLMTCS RPIIVDQRRL RPPHDHSIKC PRCDSTHTKF CYYNNYSLTQ  60
PRYFCKTCRR YWTKGGTLRN IPVGGGCRKN KKVSSKKSSN NNTNETLAAA TTTNIQEMPF  120
PLHNHHHFMS GGGASTNFGH HGNFILENQA PVIDFMESKY EALVGSTSTH SRNQDLFLGN  180
GDNDIGMMMI SGIGHDDNNI VAQNYPFGMT SMDNGNNFGM LLPYENINHH HEEVQNINNA  240
VDVKPNPKIL SLEWHDNDQL DVNKESSSYG YYSGTGGLGS WTGLMNGYGS SATNPLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755151e-115HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
GenBankHG9754421e-115HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006344507.11e-145PREDICTED: dof zinc finger protein DOF5.6-like
TrEMBLM1BJB31e-145M1BJB3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000465981e-144(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48952240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-35TARGET OF MONOPTEROS 6