PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00146.1_g00017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Dof
Protein Properties Length: 301aa    MW: 33581.3 Da    PI: 9.7518
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00146.1_g00017.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.1e-3880140262
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              +e+alkcprC+stntkfCy+nny+lsqPryfCk+CrryWtkGGalrnvPvGgg+r+n+k+s
  Sme2.5_00146.1_g00017.1  80 PETALKCPRCESTNTKFCYFNNYNLSQPRYFCKTCRRYWTKGGALRNVPVGGGSRRNNKRS 140
                              67899***************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3068132IPR003851Zinc finger, Dof-type
PfamPF027011.7E-3283138IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.16184138IPR003851Zinc finger, Dof-type
PROSITE patternPS01361086122IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MAFSSVPFYL DPPNWQHEQA NQQQQQLLGV VDHENPSQLS PVVLPPPVEG GGGGGGGGGS  60
GSIRSGSMTE RARLAKITQP ETALKCPRCE STNTKFCYFN NYNLSQPRYF CKTCRRYWTK  120
GGALRNVPVG GGSRRNNKRS RSKRARTSKS PIRSERSRID PIITSNSTTP ITFPSHLPTP  180
STHLSFLMNT PFHNFNDFNS TQNGLNFGEI QPHEGDATFV DQFRLQQMQQ FSFLSPLEQP  240
SSFYPSYSGF GISHDLENVK VEVDKSSTNS QGMNLQRNNN LRVGQFWTDY NISSTSTSQL  300
L
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138143RSRSKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755170.0HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankAC1862900.0AC186290.2 Solanum lycopersicum chromosome 5 clone C05HBa0131D04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006346013.11e-148PREDICTED: dof zinc finger protein DOF3.6
TrEMBLM1C5E81e-148M1C5E8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000602161e-148(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.18e-40OBF-binding protein 3