PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00096.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 1152aa    MW: 130571 Da    PI: 5.0638
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00096.1_g00018.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM140.69.4e-44581852128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                              ppGfrF Ptd+el+++yL++k+ + +le  + i e++iyk++P+++ +  k ++ ek wy  ++rd+ky++g+r++r++ +gyWka
  Sme2.5_00096.1_g00018.1  58 PPGFRFYPTDDELITHYLERKIGNLRLEP-NKIYEMNIYKYDPETIAAhvKPTTAEKVWYILTPRDRKYQNGHRPSRSAGNGYWKA 142
                              9*************************999.77**************852355567889**************************** PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tg d+++++ k+ +vg++k Lv+y g+apkg+kt+W+mheyrl
  Sme2.5_00096.1_g00018.1 143 TGADRDITDDKNVTVGVRKALVYYYGKAPKGQKTNWIMHEYRL 185
                              *****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-5056212IPR003441NAC domain
PROSITE profilePS5100550.7857212IPR003441NAC domain
PfamPF023655.5E-2458185IPR003441NAC domain
PROSITE profilePS5176215.971449607IPR000757Glycoside hydrolase family 16
Gene3DG3DSA:2.60.120.2001.3E-91460674IPR013320Concanavalin A-like lectin/glucanase domain
CDDcd021761.56E-119463673No hitNo description
SuperFamilySSF498997.71E-66464679IPR013320Concanavalin A-like lectin/glucanase domain
PfamPF007222.3E-57467645IPR000757Glycoside hydrolase family 16
PROSITE patternPS010340539549IPR008263Glycoside hydrolase, family 16, active site
PROSITE profilePS5176230.953608880IPR000757Glycoside hydrolase family 16
Gene3DG3DSA:2.60.120.2001.3E-99685914IPR013320Concanavalin A-like lectin/glucanase domain
CDDcd021766.42E-129688917No hitNo description
SuperFamilySSF498992.11E-69691908IPR013320Concanavalin A-like lectin/glucanase domain
PfamPF007221.6E-62693872IPR000757Glycoside hydrolase family 16
PROSITE patternPS010340766776IPR008263Glycoside hydrolase, family 16, active site
PROSITE profilePS5176228.348741093IPR000757Glycoside hydrolase family 16
CDDcd021762.35E-1269061149No hitNo description
PfamPF007224.8E-579081085IPR000757Glycoside hydrolase family 16
SuperFamilySSF498994.32E-749141151IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:2.60.120.2004.2E-1049151150IPR013320Concanavalin A-like lectin/glucanase domain
PROSITE patternPS010340979989IPR008263Glycoside hydrolase, family 16, active site
PfamPF069555.2E-1811101149IPR010713Xyloglucan endo-transglycosylase, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006073Biological Processcellular glucan metabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005618Cellular Componentcell wall
GO:0048046Cellular Componentapoplast
GO:0003677Molecular FunctionDNA binding
GO:0004553Molecular Functionhydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016762Molecular Functionxyloglucan:xyloglucosyl transferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1152 aa     Download sequence    Send to blast
MEDNHLSPTN NADISKDDLT IVSHINELPV SAVFSNKNSN GELIMSAEEI ESFIGSFPPG  60
FRFYPTDDEL ITHYLERKIG NLRLEPNKIY EMNIYKYDPE TIAAHVKPTT AEKVWYILTP  120
RDRKYQNGHR PSRSAGNGYW KATGADRDIT DDKNVTVGVR KALVYYYGKA PKGQKTNWIM  180
HEYRLPGVPD ISQRGPKDLK LDDWVLCRMY NRKDTDKTVF IQRKRSRENY ELVIDEVKDT  240
RDENLSSPQL HDPVCEVIDA DSTINDLTNY EYNFNQATIF HPQVPAGLCP FPECTYMPAF  300
CNCLSCVPQF DNGSFAHGDD TSMTNNVYHD QIAPAPMMME PISSMMPTTN SIGDDHDSMQ  360
HQGFDVSFFT SCVGGGPDEE YLELGPDPMD EFLVNNDELD AISSEYNTNN FVNEINEQVD  420
ILISQSFSSS RQNLENTPNR IVVHTIKSPE QPLQSVPVVL ENGSFNQHIM VSWGDDRGKI  480
LENGELLTLS LDKLSGSGFQ SKKEYLFAKI NMQIKLVPGN SAGTVTTFYL SSQGNKHDEI  540
DFEFLGNSTG NPYTLHTNVF SLGVGNREQQ FLLWFDPTAD YHTYSILWNP KCIIFFVDGI  600
AIREYKNPER IGLSYPKHQP MRLYSSLWNA DDWATQGGRV KTNWKLAPFL ASYRNFTFEA  660
CIYSRLTSSS SCENDSPPSP NKAWLSLAYG NFNQDFDVTW GDGRAKVLNN GKLLTLSLDK  720
ASGSGVQSKK EFLFGRIDMQ LKLVRGNSAG TVTTYYLSSQ GATHDEIDFE FLGNLSGDPY  780
IVHTNVYTQG KGDREQQFYL WFDPTADFHT YSILWNPQTI IFYVDGTPIR VFKNVKSKGL  840
PYPNNQPMRV YASLWNADDW ATRGGLVKTD WSNAPFVASF RNFNANNACV WAFGKSSCTN  900
STMPWFSQQL DSTSQARGKI INNGEILTLT LDNTSGSGFV SKREYLFGKI DMQIKLVRGN  960
SAGTVTAYYL SSEGSNHDEI DFEFLGNLSG EPYTVHTNVY TQGKGEREQQ FHLWFDPTND  1020
FHTYSVLWNP QTIVLSVENV PIREFKNLES IGVPFPKSQA MKLYSSLWNA DEWATRGGLI  1080
KTDWAQAPFT ASYTNFNANI CNNNSSCKYL AENLDPVNQE KLRMVQQKYM IYNYCTDTKR  1140
FPQGFPPECS AT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1umz_A3e-86464114916272XYLOGLUCAN ENDOTRANSGLYCOSYLASE
1umz_B3e-86464114916272XYLOGLUCAN ENDOTRANSGLYCOSYLASE
1un1_A3e-86464114916272XYLOGLUCAN ENDOTRANSGLYCOSYLASE
1un1_B3e-86464114916272XYLOGLUCAN ENDOTRANSGLYCOSYLASE
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtCatalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity). {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. Not induced following darkness. {ECO:0000269|PubMed:8696366}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8441570.0AB844157.1 Nicotiana alata NaXTH25 mRNA for endo-(1,4)-beta-D-glucanase ortholog, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006366190.11e-158PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 25
SwissprotQ389071e-119XTH25_ARATH; Probable xyloglucan endotransglucosylase/hydrolase protein 25
TrEMBLA0A3Q7H6Q80.0A0A3Q7H6Q8_SOLLC; Uncharacterized protein
STRINGXP_010485205.11e-170(Camelina sativa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.14e-53NAC family protein
Publications ? help Back to Top
  1. Akamatsu T, et al.
    Expression of endoxyloglucan transferase genes in acaulis mutants of Arabidopsis.
    Plant Physiol., 1999. 121(3): p. 715-22
    [PMID:10557219]
  2. Yokoyama R,Nishitani K
    A comprehensive expression analysis of all members of a gene family encoding cell-wall enzymes allowed us to predict cis-regulatory regions involved in cell-wall construction in specific organs of Arabidopsis.
    Plant Cell Physiol., 2001. 42(10): p. 1025-33
    [PMID:11673616]
  3. Rose JK,Braam J,Fry SC,Nishitani K
    The XTH family of enzymes involved in xyloglucan endotransglucosylation and endohydrolysis: current perspectives and a new unifying nomenclature.
    Plant Cell Physiol., 2002. 43(12): p. 1421-35
    [PMID:12514239]
  4. Li W, et al.
    Identification of quantitative trait loci controlling high Calcium response in Arabidopsis thaliana.
    PLoS ONE, 2014. 9(11): p. e112511
    [PMID:25401959]
  5. Xu W,Campbell P,Vargheese AK,Braam J
    The Arabidopsis XET-related gene family: environmental and hormonal regulation of expression.
    Plant J., 1996. 9(6): p. 879-89
    [PMID:8696366]