PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g099380.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 556aa    MW: 62780.3 Da    PI: 5.251
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g099380.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like65.68.9e-21191244155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r  W+ eLH++F+eav+   G++k +Pk+ile m+v gL +e+v+SHLQk+Rl
  Solyc12g099380.1.1 191 KARTTWSAELHRKFLEAVDFY-GINKVVPKKILERMNVAGLKREQVASHLQKHRL 244
                         689****************99.********************************7 PP

2Response_reg76.11.3e-25181261109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         +l+vdD+ + +++l+q l+k +y ev+++  +e+al ll++++  ++l+++D+ +p+mdG+ellk+i  e  +lp+++++a ++ + a ++
  Solyc12g099380.1.1  18 LLVVDDDTFYLNNLEQTLKKCQY-EVTTCNRAEDALSLLRDNKnnFHLVIIDVHIPDMDGFELLKHIVLEM-NLPVVMMSADDSRSVAMKC 106
                         599********************.***************777777**********************8865.9****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga+ +l Kp+++e l +
  Solyc12g099380.1.1 107 VIDGAHYCLIKPVSMESLQN 126
                         **************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.55E-3115134IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.2E-3516163No hitNo description
SMARTSM004482.3E-2516128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011037.28517132IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-2119126IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.98E-2419131No hitNo description
SuperFamilySSF466895.02E-17188248IPR009057Homeodomain-like
PROSITE profilePS5129410.089188247IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-21190247IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-21191246IPR006447Myb domain, plants
PfamPF002493.6E-6193243IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005622Cellular Componentintracellular
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MSTSGACMNS GEFPTFRLLV VDDDTFYLNN LEQTLKKCQY EVTTCNRAED ALSLLRDNKN  60
NFHLVIIDVH IPDMDGFELL KHIVLEMNLP VVMMSADDSR SVAMKCVIDG AHYCLIKPVS  120
MESLQNIWQH IVRQNKDEWK CKILDQSGDV EQPKEVEYSC VTNEVRLKSS KKKRAEGYEM  180
EERSDTTTLK KARTTWSAEL HRKFLEAVDF YGINKVVPKK ILERMNVAGL KREQVASHLQ  240
KHRLIQRKNQ SEQNNACMGD SEATIGTMSN RFQPLAPISQ FPAQNLAIWG RPATNSPMFV  300
PLADQRNHFS FENSMLRYQG QQQMNNRNEQ TNLLYGIPTA VEQNPSYFGM NMPVGRISQP  360
QLQAHNMLRE SNKFLSQNGL VHNPRDSMYN QFPRASSSAI DCSLNQNISF AGSTFPMSGN  420
SATSTTKEDV NSDDIFNELY QENVGSTLDT SYHSSIHHGI WSMEQSGQNV NSNTLIAEAV  480
LCSGQEIGHV NPVPRPYVNA ERYPSSSYQS ATFPEPSDQD LMSAMLEQQQ QESDEPVAYA  540
QFCDDNEDAL GNFPT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-15187248162ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g099380.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027769643.10.0two-component response regulator ARR2
TrEMBLA0A3Q7JEN60.0A0A3Q7JEN6_SOLLC; Uncharacterized protein
STRINGSolyc12g099380.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14508910
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-94response regulator 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]