PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g099340.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CAMTA
Protein Properties Length: 916aa    MW: 103940 Da    PI: 7.1782
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g099340.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1151.81.6e-47301513118
                CG-1   3 ke.kkrwlkneeiaaiLenfekheltlelktrpk.....sgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYah 87 
                         +e k rwl+++ei+aiL n++ +++  ++ + pk     sg+++L++rk++r+fr+DGy+wkkkkdgktv+E+he+LKvg+ e +++yYah
  Solyc12g099340.1.1  30 EEsKMRWLRPNEIHAILCNHKYFNINVKPVNLPKsnlilSGTIVLFDRKMLRNFRRDGYNWKKKKDGKTVKEAHEHLKVGNDERIHVYYAH 120
                         44499*********************988888873333469************************************************** PP

                CG-1  88 seenptfqrrcywlLeeelekivlvhylevk 118
                         +e+n+tf rrcywlL+++le++vlvhy+e++
  Solyc12g099340.1.1 121 GEDNTTFVRRCYWLLDKTLEHVVLVHYRETQ 151
                         ****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143769.58925156IPR005559CG-1 DNA-binding domain
SMARTSM010762.4E-6928151IPR005559CG-1 DNA-binding domain
PfamPF038596.3E-4232149IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.102.0E-5359461IPR013783Immunoglobulin-like fold
SuperFamilySSF812961.96E-12372459IPR014756Immunoglobulin E-set
CDDcd002045.41E-16557667No hitNo description
PfamPF127964.1E-7557637IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.207.9E-17557671IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484034.04E-18558672IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029715.698566679IPR020683Ankyrin repeat-containing domain
SMARTSM002481.8E-6608637IPR002110Ankyrin repeat
PROSITE profilePS5008811.701608640IPR002110Ankyrin repeat
SuperFamilySSF525405.84E-6750821IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM0001514770792IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.236771800IPR000048IQ motif, EF-hand binding site
PfamPF006120.1773791IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0087793815IPR000048IQ motif, EF-hand binding site
PROSITE profilePS5009610.072794818IPR000048IQ motif, EF-hand binding site
PfamPF006126.8E-4795815IPR000048IQ motif, EF-hand binding site
SMARTSM0001525869891IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.37870899IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0001077Molecular Functiontranscriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 916 aa     Download sequence    Send to blast
MESSVSGRLL GCEIHGFRTM QDLDIPNIME ESKMRWLRPN EIHAILCNHK YFNINVKPVN  60
LPKSNLILSG TIVLFDRKML RNFRRDGYNW KKKKDGKTVK EAHEHLKVGN DERIHVYYAH  120
GEDNTTFVRR CYWLLDKTLE HVVLVHYRET QEVSSNSTVA QGSPAAPVSS GSALSDPADL  180
SASWVLSGEL DSAVDQQYSA SRHAHLEPNR DMTVQNHEQR LLEINTLEWD DLLAPGDPNK  240
MVATQQAVGK TAYVQHTSYE QRNLCELNGY SFDGGVSSSL ERISTFNNSN EITFQTVDGQ  300
MTSSFEKNES GVMTVSTGDS LDSLNQDRLQ TQDSFGRWMN YLIKDSPESI DDPTPESSVS  360
TGQSYAREQI FNITEILPAW APSTEETKIC VIGQFHGEQS HLESSSLRCV CGDACFPAEV  420
LQPGVYRCIV SPQTPGLVNI YLSFDGNKPI SQVMSFEFRA PSVHVWTEPP ENKSDWDEFR  480
NQMRLAHLLF STSKSLNILS SKIHQDLLKD AKKFAGKCSH IIDDWACLIK SIEDKKVSVP  540
HAKDCLFELS LKTRLQEWLL ERVVEGCKIS EHDEQGQGVI HLCAILGYTW AVYPFSWSGL  600
SLDYRDKYGW TALHWAAYYG REKMVATLLS AGAKPNLVTD PTSENLGGCT ASDLASKNGH  660
EGLGAYLAEK ALVAQFKDMT LAGNISGSLQ TTTESINPGN FTEEELNLKD SLTAYRTAAD  720
AAARIQAAFR ERALKVRTKA VESSNPEMEA RNIIAAMKIQ HAFRNYEMQK QLAAAARIQY  780
RFRTWKMRKE FLHMRRQAIK IQAVFRGFQV RRQYRKIIWS VGVLEKALFR WRLKRKGLRG  840
LKLQSTQVTK PDDVEEDFFQ ASRKQAEERI ERSVVRVQAM FRSKQAQEQY RRMKLEHDKA  900
TLEYEGTLNP DTEMD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.67940.0fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, pollen, top of sepals and siliques. {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:14581622}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:14581622). Binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in response to cold. Contributes together with CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:28351986). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:14581622, ECO:0000269|PubMed:28351986, ECO:0000305|PubMed:11925432}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00435DAPTransfer from AT4G16150Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g099340.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat shock, UVB, wounding, abscisic acid, H(2)O(2) and salicylic acid. {ECO:0000269|PubMed:12218065}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN5660510.0Solanum lycopersicum calmodulin-binding transcription factor SR3L mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266140.10.0calmodulin-binding transcription factor SR3L
SwissprotO234630.0CMTA5_ARATH; Calmodulin-binding transcription activator 5
TrEMBLH8ZRY60.0H8ZRY6_SOLLC; Calmodulin-binding transcription factor SR3L
STRINGSolyc12g099340.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45652232
Representative plantOGRP73511116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16150.10.0calmodulin binding;transcription regulators
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Ye J, et al.
    Arabidopsis formin3 directs the formation of actin cables and polarized growth in pollen tubes.
    Plant Cell, 2009. 21(12): p. 3868-84
    [PMID:20023198]
  3. Kidokoro S, et al.
    Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.
    Plant Cell, 2017. 29(4): p. 760-774
    [PMID:28351986]
  4. Lan Y,Liu X,Fu Y,Huang S
    Arabidopsis class I formins control membrane-originated actin polymerization at pollen tube tips.
    PLoS Genet., 2018. 14(11): p. e1007789
    [PMID:30418966]