PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g099220.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 576aa    MW: 66357.1 Da    PI: 5.2741
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g099220.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS285.61.4e-871905601374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn.sseelaalklfsevsP 89 
                         lve Ll+ Ae v ++    a  lL++  +l+ ++g p++Rl+ yf +AL++r+   +++++ k l  ++ ++ + + ++++a ++ ++  P
  Solyc12g099220.1.1 190 LVERLLASAEKVGEKVYDIAIDLLNECDKLSYKTGHPVERLVYYFSRALRERVDIeTGKNCTKGLGIRRMRDLQeTLRSINACTIAVQDMP 280
                         57899************************************************876999******98888876558888999999****** PP

                GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                         + ++  ++  qaIle ve+++++Hi+D++i++G+QW  L+qaLa++ ++   l++T++ + +  s++++eetg+rL +fA++l+ p+ f++
  Solyc12g099220.1.1 281 MCEVVKFAGIQAILENVESSKKIHIVDLEIKMGVQWTILMQALATQCSNLEYLKVTALIDVQ--SRTNVEETGKRLMSFAKSLHFPLCFKI 369
                         ************************************************************66..*************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                         ++++++ dl+ e+L+++p+E+laV +++ l ++     + +++ d ++ ++k+l+P+++vv+e ea++ns+ F++rf+eal y+ a fd +
  Solyc12g099220.1.1 370 VMVEDIFDLKREDLDIDPEESLAVYSQFLLSNMI----THQDRLDFLMGFIKGLNPRIMVVAEVEANLNSPVFVNRFIEALFYHGAYFDLF 456
                         ****************************999998....555567779******************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                         e  + +++++r+ +E+e++   i+n++a+eg+er++rh t e Wre ++++G+ ++++s++   qak++++k+  ++ +++e +++ +++g
  Solyc12g099220.1.1 457 EDCMRNNESTRNAMEEEVMWHGIRNIIANEGEERTMRHVTIELWREYFKRFGMVEMKMSDSSLYQAKTVVEKFTgKNSFTLEMNENFVTIG 547
                         ****9999******************************************************************9999************* PP

                GRAS 362 WkdrpLvsvSaWr 374
                         Wk+ pL s+SaW+
  Solyc12g099220.1.1 548 WKGTPLNSLSAWK 560
                         ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.677164539IPR005202Transcription factor GRAS
PfamPF035145.0E-85190560IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MEDASGTSEF FLVKESLSSS SGTIRRFYTG FCFWRQHVCC CLASKLIQTN MEKSIIWPFY  60
EPEEKTNSMQ EQNEQYSVKL DDWDFDVVDK TTTILSIKEA TDDNKRANNS LISSLNILKD  120
FGNGFRKLKG QKIDVAQISE NECTSSVCKL SAEEILRFGG QKFMQRIEFD HTFVDSLCSL  180
SEEESRSVML VERLLASAEK VGEKVYDIAI DLLNECDKLS YKTGHPVERL VYYFSRALRE  240
RVDIETGKNC TKGLGIRRMR DLQETLRSIN ACTIAVQDMP MCEVVKFAGI QAILENVESS  300
KKIHIVDLEI KMGVQWTILM QALATQCSNL EYLKVTALID VQSRTNVEET GKRLMSFAKS  360
LHFPLCFKIV MVEDIFDLKR EDLDIDPEES LAVYSQFLLS NMITHQDRLD FLMGFIKGLN  420
PRIMVVAEVE ANLNSPVFVN RFIEALFYHG AYFDLFEDCM RNNESTRNAM EEEVMWHGIR  480
NIIANEGEER TMRHVTIELW REYFKRFGMV EMKMSDSSLY QAKTVVEKFT GKNSFTLEMN  540
ENFVTIGWKG TPLNSLSAWK FHKRSTFHIA NYLTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3722356036375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2397381e-20Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-240p19 map 1, complete sequence
GenBankAM0872001e-20Solanum lycopersicum complete chloroplast genome, cultivar IPA-6
GenBankDQ3479591e-20Lycopersicon esculentum cultivar LA3023 chloroplast, complete genome
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004253154.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLK4DHU30.0K4DHU3_SOLLC; Uncharacterized protein
STRINGSolyc12g099220.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34272149
Representative plantOGRP2520734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-51RGA-like 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]