PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g096500.1.1
Common NameLOC101254368
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CO-like
Protein Properties Length: 359aa    MW: 39504.9 Da    PI: 5.7262
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g096500.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box186e-061143436
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                        + C+ ++  +++ fC+ ++ +lC  C  ++H  
  Solyc12g096500.1.1 11 KLCDSCKTSPATVFCRADSAFLCLGCDCKIHAA 43
                        68*************************999954 PP

2zf-B_box25.33.2e-085395339
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                         ++C+ +e+ +++  C+ +   lC +C   +H+       H++
  Solyc12g096500.1.1 53 VWVCEVCEQAPASVTCKADAAALCVTCDRDIHSAnplarrHER 95
                        689*****************************65777777776 PP

3CCT70.54.1e-24295338144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Solyc12g096500.1.1 295 REARVMRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 338
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.0E-10855IPR000315B-box-type zinc finger
PROSITE profilePS5011910.068855IPR000315B-box-type zinc finger
PfamPF006433.6E-51150IPR000315B-box-type zinc finger
CDDcd000211.84E-71255No hitNo description
PROSITE profilePS5011910.5945198IPR000315B-box-type zinc finger
PfamPF006432.2E-65397IPR000315B-box-type zinc finger
CDDcd000213.24E-95498No hitNo description
SMARTSM003361.6E-105698IPR000315B-box-type zinc finger
PfamPF062032.4E-18295337IPR010402CCT domain
PROSITE profilePS5101716.896295337IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGTENWSLTA KLCDSCKTSP ATVFCRADSA FLCLGCDCKI HAANKLASRH ARVWVCEVCE  60
QAPASVTCKA DAAALCVTCD RDIHSANPLA RRHERFPVVP FYDFAVAKSH GGGDTDADAV  120
DDEKYFDSTN ENPSQPEEEA EAASWILPTP KEGTDQYKSA DYLFNDMDSY LDIDLMSCEQ  180
KPHILHHQQH QHNHYSSDGV VPVQNNNETT HLPGPVVDGF PTYELDFTGS KPYMYNFTSQ  240
SISQSVSSSS LDVGVVPDHS TMTDVSNTFV MNSSSGAIAG AGADVVPNAV SGLDREARVM  300
RYREKRKNRK FEKTIRYASR KAYAETRPRI KGRFAKRTET EIDSLITVDA SYGVVPSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.29210.0callus| floral bud| flower| fruit| leaf| root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g096500.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0132600.0Lycopersicon esculentum clone 134795F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004253053.10.0zinc finger protein CONSTANS-LIKE 4
SwissprotQ940T91e-104COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A3Q7JCU50.0A0A3Q7JCU5_SOLLC; Uncharacterized protein
STRINGSolyc12g096500.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-96CONSTANS-like 4
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]