PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g096070.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRF
Protein Properties Length: 346aa    MW: 38590.8 Da    PI: 7.5494
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g096070.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.33.1e-2471115145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRC +++++++k+CErH+hrgr+rsrk++e+
  Solyc12g096070.1.1  71 DPEPGRCRRTDGKKWRCAKDAYPDSKYCERHMHRGRNRSRKHVES 115
                         79****************************************986 PP

2QLQ62.79.8e-221045237
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        +FTa Q+q+L++Q+++yKyL+a+ PvP++L+++i++
  Solyc12g096070.1.1 10 PFTAVQWQELEHQAMIYKYLVAGIPVPADLVVPIRR 45
                        9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.0E-12945IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.1E-161044IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.0181045IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.81171115IPR014977WRC domain
PfamPF088792.7E-2072114IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MAAENGYRPP FTAVQWQELE HQAMIYKYLV AGIPVPADLV VPIRRSFEPI SARFFHHPSL  60
GYCSYYGKKF DPEPGRCRRT DGKKWRCAKD AYPDSKYCER HMHRGRNRSR KHVESQSTAQ  120
SLLTSMSHNT TGSTTGSSKT SGNFQRNSSE SFQNTPLYSA ANSEGPSYGS ATTKMQMEPP  180
TYAIDSKGYF HGMTADADEQ NFSLEASEGT RSLGMGSNTD SMWCLMPPQL PSSPMVKPKN  240
DSQLLDSSRQ IRMPNPFEPM NDTTISGQHQ HCFFSSDIGS PGTVKQEQRS MRPFFDEWPT  300
TKESWSNLDD EGSNKNNFST TQLSISIPMA PPDFSSRSSC SPNDA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.75976e-92flower| fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g096070.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010314818.10.0growth-regulating factor 4 isoform X2
TrEMBLA0A3Q7JCL00.0A0A3Q7JCL0_SOLLC; Uncharacterized protein
STRINGSolyc12g096070.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7432384
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-48growth-regulating factor 5
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]