PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g077540.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Trihelix
Protein Properties Length: 302aa    MW: 33964.9 Da    PI: 6.5272
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g077540.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix82.36.7e-2650131286
            trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         W ++e+++Li +rre+++ ++++k++k+lW+++s kmre+gf rsp++C++kw+nl k++kk k+++ ++    s +++y+++++
  Solyc12g077540.1.1  50 WVQEETRVLIGLRREIDSLFNTSKSNKHLWDQISMKMREKGFDRSPTMCTDKWRNLLKEFKKAKQNQDRN---GSAKMSYYKEID 131
                         *****************************************************************99984...566899***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-440111IPR009057Homeodomain-like
PROSITE profilePS500908.5642106IPR017877Myb-like domain
SMARTSM007170.002446108IPR001005SANT/Myb domain
CDDcd122034.09E-2748113No hitNo description
PfamPF138377.3E-2149133No hitNo description
PROSITE profilePS500903.938255301IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MVDVVTSNSQ QQILMGGGGG GGDTTSSGGE ENCTNPCSDV KTPKKRAETW VQEETRVLIG  60
LRREIDSLFN TSKSNKHLWD QISMKMREKG FDRSPTMCTD KWRNLLKEFK KAKQNQDRNG  120
SAKMSYYKEI DEILRDRTNT PLPPPPKVDS FMHFAQKGLD DTSITFGPVE ENGRPTLNLE  180
RRLDHDGHPL AITAADAVTA SGVSPWNWRE PHGTGEPSQS YEGRVISVKW GDYTKRIGID  240
GTADAIKEAI KSAFRLRTKR AFWLEDEDNI VRTLDRDMPL GNYTLHVDEG PQYGTDDWNR  300
T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A3e-4444129186DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.161500.0floral bud| fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00640PBMTransfer from MDP0000164819Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010314571.10.0PREDICTED: trihelix transcription factor GT-1-like isoform X3
SwissprotQ9FX531e-135TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLK4DGH40.0K4DGH4_SOLLC; Uncharacterized protein
STRINGSolyc12g077540.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP59331318
AsteridsOGEA51132136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.11e-135Trihelix family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]