PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g056860.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 349aa    MW: 39559.3 Da    PI: 7.1157
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g056860.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.87.4e-1164104343
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNk 43 
                         ++k++rr+++NReAAr+sR RKka++++Le+   +L +  +
  Solyc12g056860.1.1  64 SDKVQRRLAQNREAARKSRMRKKAYVQQLEKSNLKLAQLEM 104
                         68****************************86655555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-462125IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.10564108IPR004827Basic-leucine zipper domain
PfamPF001701.3E-765104IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.38E-766102No hitNo description
Gene3DG3DSA:1.20.5.1704.9E-866109No hitNo description
PROSITE patternPS0003606984IPR004827Basic-leucine zipper domain
PfamPF141446.0E-29153225IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGIFEPFHHM SMWEDAFRGD IMPSVGACMI TPANDRADDK SGYTSSDQLI PSGSEDNQAG  60
KSISDKVQRR LAQNREAARK SRMRKKAYVQ QLEKSNLKLA QLEMELERAR QQGLYILGSN  120
GNMGLSSTIN PGIAAFEMEY SLWVEEQQKK NVELRNILQS HVSEMELQLL VETVLNHYYN  180
LFRIKADAAK ADVFYLMSGM WRTSVERFFL WIGGFKPSEL INIVMPQLEP LSDQQIVKIC  240
NLRHCCQQAE DALTQGMDKL QQTLAQNILT MTTGMGSYSS QMVSSMEKLE ALESFVNQAD  300
HLRQQTLQQM SLVLTTRQSA RGLLAFGEYL QRLRALSSLW AARPREPT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.80200.0flower| fruit| leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g056860.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004252551.10.0transcription factor TGA1
SwissprotQ93ZE21e-149TGA7_ARATH; Transcription factor TGA7
TrEMBLM1BF040.0M1BF04_SOLTU; Uncharacterized protein
STRINGSolyc12g056860.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Representative plantOGRP26791132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.11e-151bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]