PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g056510.1.1
Common NameLOC101262091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Trihelix
Protein Properties Length: 652aa    MW: 72092.5 Da    PI: 7.0805
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g056510.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.81.7e-2972155186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         rW++qe+laL+++r+em+  +++++lk+plWeevs+k++e g++rs+k+Ckek+en+ k+++++k+g+ ++   + +t+++fdql+
  Solyc12g056510.1.1  72 RWPRQETLALLKIRSEMDVVFKDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKYHRRTKDGRASK--ADGKTYRFFDQLQ 155
                         8********************************************************************96..66678******98 PP

2trihelix101.75.7e-32457542187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW+k+e+ aLi +r+ ++ +++++  k+plWee+s+ mr+ g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+qlea
  Solyc12g056510.1.1 457 RWPKEEIEALISLRTCLDLKYQENGPKGPLWEEISSGMRKIGYNRNAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLEA 542
                         8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.14365129IPR017877Myb-like domain
SMARTSM007170.00269131IPR001005SANT/Myb domain
CDDcd122031.88E-2471136No hitNo description
PfamPF138374.9E-1971157No hitNo description
SMARTSM007170.0024454516IPR001005SANT/Myb domain
PfamPF138371.7E-21456543No hitNo description
PROSITE profilePS500907.399456514IPR017877Myb-like domain
CDDcd122031.42E-27456521No hitNo description
Gene3DG3DSA:1.10.10.609.5E-4456513IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MLGVSSSLIA SSNTSITAGA AGDGAAISAA PSQLAPPPQE APESGGSSEG GGGGGDLSIG  60
GEDGERNSGG NRWPRQETLA LLKIRSEMDV VFKDSSLKGP LWEEVSRKLA ELGYHRSAKK  120
CKEKFENVYK YHRRTKDGRA SKADGKTYRF FDQLQALENN PSSHSNIPPP PLAATPITMA  180
MPMRSGNNSA NPPMPTPTPT PQNHNHFFSV SQKSVVTGAA QPAVMTAPAL PLSQVPIGNN  240
NLNQMHRPQG NTTTTKTSFL SNSTSSSSST SSDEDIQRRQ MKKRKWKEFF ESLMKDVIEK  300
QEELQKKFLE TLEKRERDRL MREEAWRVQE MARLNREHDL LVQERSMAAA KDATIIAFLQ  360
KITEQQNTQT PNSTNNTSPS PFPIAQIQLK LSEKPFSTPP QPQPQPSATA VSLPMTIHTP  420
TPAPPQTLTL PVVSSKSLEP PKSDNGGENF SPASSSRWPK EEIEALISLR TCLDLKYQEN  480
GPKGPLWEEI SSGMRKIGYN RNAKRCKEKW ENINKYFKKV KESNKKRPED SKTCPYFHQL  540
EALYKEKAKL EPVPHNTTFG LTPQNNPPPP PPPIMAQPEQ QWPIPQNQLH QQNRDHHHDN  600
ESDSMDHDLE EDEDEDEEDE GNGYEIIITN KQQSSSMAAT PVTTTTSAAA V*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276284QRRQMKKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.82710.0callus| fruit| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g056510.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2329351e-15Solanum lycopersicum chromosome 9 clone C09HBa0067J16, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010314480.10.0trihelix transcription factor GT-2-like
TrEMBLA0A3Q7JB430.0A0A3Q7JB43_SOLLC; Uncharacterized protein
STRINGSolyc12g056510.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24022459
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.19e-65Trihelix family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]