PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g049320.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 268aa    MW: 29779.8 Da    PI: 5.8861
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g049320.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS48.22e-15159251294
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL  cA a+++g+l+++q+lL  l+el+s +gd+++Rlaa  ++AL   l+  +++  ++ ++ + +++n +   ++l  f+e+sP+++
  Solyc12g049320.1.1 159 EQLLNPCAAAITAGNLNRVQHLLYVLRELSSLNGDANHRLAARGLQALTYYLSTPCPTSLSSASAATFASTNPKFFKNSLINFNEISPWFR 249
                         689************************************************************9999999999999999999********9 PP

                GRAS  93 fs 94 
                         + 
  Solyc12g049320.1.1 250 IP 251
                         76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098510.847132267IPR005202Transcription factor GRAS
PfamPF035146.7E-13159251IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MTIDETTSDP ISEWLDSPLS YFPSLLDDES YSIDDLLDES YSLDDIYEDS WWAPNESINQ  60
EIHINNNNDN SLPCFDTSFP VTTASTVSLE PVISSHLPPL DSSKKRKGND SGYNPKASRK  120
NQNRRINDAD TRRTTGHKKA THKSSTGNNG NNREGRWAEQ LLNPCAAAIT AGNLNRVQHL  180
LYVLRELSSL NGDANHRLAA RGLQALTYYL STPCPTSLSS ASAATFASTN PKFFKNSLIN  240
FNEISPWFRI PNSIFLMVFN GQHCSRS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g049320.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004252517.20.0nodulation-signaling pathway 1 protein-like
TrEMBLA0A3Q7J9R10.0A0A3Q7J9R1_SOLLC; Uncharacterized protein
STRINGSolyc12g049320.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49492139
Representative plantOGRP40821525
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.17e-27GRAS family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]